PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462858624
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 245aa    MW: 28470.6 Da    PI: 9.5019
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462858624genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF983.9e-31959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krienk+nrqvtfskRrng+lKKA+E+SvLCdaev +iifs++gklyey++
  462858624  9 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVGLIIFSTKGKLYEYAT 59
               79***********************************************86 PP

2K-box104.99.7e-3578173499
      K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                +   s+e++++ ++++e++kLk+++e++q+ q+hl+Ge+Le+L+lkeLqqLeqqLe+slk+iRs+K++l+le+i+elq+ke++lqeenk L+k+l 
  462858624  78 KVLISAESETQGNWCHEYRKLKAKVETIQKCQKHLMGEELETLNLKELQQLEQQLESSLKHIRSRKSQLMLESISELQRKERSLQEENKVLQKELT 173
                555667888999********************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.758161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.23E-34289IPR002100Transcription factor, MADS-box
CDDcd002651.58E-41276No hitNo description
PRINTSPR004047.9E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-323859IPR002100Transcription factor, MADS-box
PfamPF014861.9E-2984172IPR002487Transcription factor, K-box
PROSITE profilePS5129717.53488178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009933Biological Processmeristem structural organization
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVGLIIFST KGKLYEYATD  60
HCMDKILERY ERYSYAEKVL ISAESETQGN WCHEYRKLKA KVETIQKCQK HLMGEELETL  120
NLKELQQLEQ QLESSLKHIR SRKSQLMLES ISELQRKERS LQEENKVLQK ELTEKQKVHR  180
QQVQWEHTQQ PQTSSSSSPF MMREAPPAVN VSNYPAATGV RVDGPAEQPQ VRIGLPPWML  240
SHLSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A5e-22174173MEF2 CHIMERA
6bz1_B5e-22174173MEF2 CHIMERA
6bz1_C5e-22174173MEF2 CHIMERA
6bz1_D5e-22174173MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. May be involved in the control of flowering time. {ECO:0000269|Ref.9}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00096ChIP-seqTransfer from AT1G69120Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap462858624
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ7929710.0DQ792971.1 Eragrostis pilosa fruitful-like MADS-box transcription factor (FUL1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981740.11e-139MADS-box transcription factor 14 isoform X1
SwissprotQ10CQ11e-133MAD14_ORYSJ; MADS-box transcription factor 14
TrEMBLA0A0A9QQM81e-148A0A0A9QQM8_ARUDO; Uncharacterized protein
STRINGBRADI1G08340.11e-131(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115137113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.12e-76MIKC_MADS family protein
Publications ? help Back to Top
  1. Jia H, et al.
    Characterization and transcriptional profiles of two rice MADS-box genes.
    Plant Sci., 2000. 155(2): p. 115-122
    [PMID:10814814]
  2. Jang S,An K,Lee S,An G
    Characterization of tobacco MADS-box genes involved in floral initiation.
    Plant Cell Physiol., 2002. 43(2): p. 230-8
    [PMID:11867703]
  3. Kim SL,Lee S,Kim HJ,Nam HG,An G
    OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a.
    Plant Physiol., 2007. 145(4): p. 1484-94
    [PMID:17951465]
  4. Li D, et al.
    Functional characterization of rice OsDof12.
    Planta, 2009. 229(6): p. 1159-69
    [PMID:19198875]
  5. Tanaka N, et al.
    The COP1 ortholog PPS regulates the juvenile-adult and vegetative-reproductive phase changes in rice.
    Plant Cell, 2011. 23(6): p. 2143-54
    [PMID:21705640]
  6. Kobayashi K, et al.
    Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene.
    Plant Cell, 2012. 24(5): p. 1848-59
    [PMID:22570445]
  7. Wei X, et al.
    Fine mapping of BH1, a gene controlling lemma and palea development in rice.
    Plant Cell Rep., 2013. 32(9): p. 1455-63
    [PMID:23689259]
  8. Su L,Shan JX,Gao JP,Lin HX
    OsHAL3, a Blue Light-Responsive Protein, Interacts with the Floral Regulator Hd1 to Activate Flowering in Rice.
    Mol Plant, 2016. 9(2): p. 233-244
    [PMID:26537047]
  9. Wu F, et al.
    The ABCs of flower development: mutational analysis of AP1/FUL-like genes in rice provides evidence for a homeotic (A)-function in grasses.
    Plant J., 2017. 89(2): p. 310-324
    [PMID:27689766]