PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462858475
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 180aa    MW: 19951.2 Da    PI: 9.8164
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462858475genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP68.11.8e-212403977
               EEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP 39 eqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
                qrfCqqCsrfhe++efD++k+sCr+rLa+hn+rrrk++
  462858475  2 PQRFCQQCSRFHEVDEFDDAKKSCRQRLADHNRRRRKPK 40
               59***********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114118.674139IPR004333Transcription factor, SBP-box
PfamPF031102.9E-15238IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.104.5E-11226IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.67E-18242IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MPQRFCQQCS RFHEVDEFDD AKKSCRQRLA DHNRRRRKPK LSSTDVLLKK RAHAKKPATA  60
NDKGSNSKSM GTGDVLVENA SKDHGQGISN GEVVGAPVDP KGRSPMKQQA RIPQQNLQQD  120
FQFLLPPGSS TSLHQSQLVS SGSTSNTGQV QEPCVAFHQN HQHGNILQLG QTVFDLDFDH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-131384784squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12138KKSCRQRLADHNRRRRKP
23350RRRRKPKLSSTDVLLKKR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that plays an important role in building the laminar joint between leaf blade and leaf sheath boundary, thereby controlling ligule and auricle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462858475
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960135.16e-50protein LIGULELESS 1
SwissprotQ01KM78e-48SPL8_ORYSI; Squamosa promoter-binding-like protein 8
TrEMBLA0A3S6H5M92e-56A0A3S6H5M9_9POAL; Squamosa-promoter binding protein-like protein (Fragment)
STRINGOPUNC04G25460.11e-50(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69903452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.11e-17squamosa promoter binding protein-like 9