PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462856946
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family SBP
Protein Properties Length: 621aa    MW: 67729.9 Da    PI: 6.3897
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462856946genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP112.91.9e-35125200176
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                +Cqv+gCead+ e+k yhrrh+vC  +++a++v+++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k
  462856946 125 RCQVPGCEADIRELKGYHRRHRVCLRCAHAAAVMLDGVQKRYCQQCGKFHILVDFDEDKRSCRRKLERHNKRRRRK 200
                6************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-27121187IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.615123200IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-33124203IPR004333Transcription factor, SBP-box
PfamPF031103.9E-27126200IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 621 aa     Download sequence    Send to blast
MSVQMDPADA AGGGVDAGEP VWDWGNLLDF VVQDDDALVL PWDDAAGIGA ADPTEAGASL  60
LATPPPQPVE VEDVAAELLA GARKKPKTAG RRGKAGAAGP AGGGRVAAAS GGAGGTGGAA  120
AVEMRCQVPG CEADIRELKG YHRRHRVCLR CAHAAAVMLD GVQKRYCQQC GKFHILVDFD  180
EDKRSCRRKL ERHNKRRRRK PGSKGPFEKE MDEHFDLSAD ISGDGELREE NIEGTTSEML  240
ETVLSSKFLD TETPVGSEDV LSSPTCTEPT LQNEQSKSIV TFAASVEACI GAKQENVKLN  300
SSPVHDTKSA YSSSCPTGRI SFKLYDWNPA EFPRRLRHQI FEWLASMPVE LEGYIRPGCT  360
ILTVFIAMPQ HMWDKLSDDA ANLLRNLVNS PTSLLLGKGT FFIHTDNMIF QVLKDGVTLM  420
STRIEMQAPR IHYVHPTWFE AGKPVELHLC GSSLDHPKFR SLVSFDGDYL KHDCFRLASL  480
DAFDCVEKGD LTLDSQHEIF RISISRSRSD THGPAFVENT GPCGDNYLQS TSAACEEEVT  540
VPLMTKDASH RQCCHPEINA RWLKPSLVIT FPGGATRMRL LTTVVVAAVL CFTACVVLFH  600
PHRAGVLAAP VKRYLSRDSA S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A4e-38125205585squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182200KRSCRRKLERHNKRRRRKP
2186198RRKLERHNKRRRR
3193200NKRRRRKP
4194199KRRRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462856946
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805456.10.0squamosa promoter-binding-like protein 9
SwissprotQ6I5760.0SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLA0A2T8KJS30.0A0A2T8KJS3_9POAL; Uncharacterized protein
STRINGGRMZM2G109354_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69223344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.21e-108squamosa promoter binding protein-like 7
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]