PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462855272
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 1353aa    MW: 151477 Da    PI: 6.1703
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462855272genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS163.41.9e-503675461181
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL++cA+avs +d + a++lL ++++++sp+gd++qRla+yf+ +L+arla+++s++yk+l +++ts   ++e l+a +l+  ++ +   ++   N 
  462855272 367 LRTLLIHCAQAVSMDDRRSATELLVQIKQHSSPRGDANQRLAHYFAVGLEARLAGTGSQVYKSLMTKHTS---VVEFLKACQLYLAACCFEMTAFRFSNM 463
                6789***************************************************************999...*************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                +I +av g ++vHi+D+++++G+QWp+Ll  +++ ++gpp++RiTg++ p++g   + ++eetg+rL++ A+++gvpf+f+ +
  462855272 464 TICKAVVGRKKVHIVDYGVQYGFQWPSLLAFFSTWEGGPPEVRITGIDLPQPGfrPASRVEETGRRLSNCAHQFGVPFKFHGI 546
                ****************************************************9*9**************************96 PP

2GRAS172.24.1e-53547765140355
       GRAS 140 pslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvksls 235
                +++RiTg++ p++g   + ++eetg+rL++ A+ +gvpf+f+  +a +++++++++L+++p+E+l++n+++q  +l+de v ++s  +rd vL+ +++++
  462855272 547 AEVRITGIDLPQPGfrPASRVEETGRRLSNCAHLFGVPFKFHG-IAAKWDAISVDDLDIDPDEVLIINSIIQFGNLMDEGVYIHSpsPRDVVLNNIQKMR 645
                579**********9*9***************************.799*********************************99988889************ PP

       GRAS 236 PkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaak 335
                P++++++  + +++ + F++rf eal yysa+fd+l+a+ pr++e+r  +Ere++gr ++nv+aceg++r  r et+++W+ r ++aG++++pl  +++k
  462855272 646 PDMFILCVVNGSYGVPFFVTRFREALFYYSAMFDMLDATSPRDNEQRLLIEREIIGRYAMNVIACEGFDRADRPETYKQWQVRNHRAGLRQLPLYPDIVK 745
                **************************************************************************************************** PP

       GRAS 336 qaklllrkvksdgyrveees 355
                  +  +++ + + + ++ee+
  462855272 746 ILREKVKNQYHKDFVIDEED 765
                *********9888**99884 PP

3GRAS340.92.3e-10497213432373
       GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99  
                 ++lLl+cA+av+++d + a++lL +++++as++gd +qRla +f+e+L+arla+++s+ly++l +++ts   +++ l+a+klf  ++ + k+++   N
  462855272  972 QTLLLHCAQAVATDDRRSAHELLRKIKQHASSSGDGVQRLAYCFAEGLEARLAGTGSQLYQSLMVRRTS---VVDFLKAYKLFMAACCCKKVAFTFSN 1066
                 689*****************************************************************9...************************** PP

       GRAS  100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195 
                 ++I +a++g +r+Hi+D+++++G+QWp Ll+ La+R++gpp++RiTg++ p++g   + ++eetg++L+k A+e+gvpf+f+  +a + e++++e+L+
  462855272 1067 KTIHDAMAGRTRLHIVDYGLNYGFQWPGLLRGLAAREGGPPEVRITGIDLPQPGfrPAYQIEETGRQLSKCAREFGVPFRFHG-IAAKRETIRPEDLN 1163
                 *****************************************************99999*************************.69999********* PP

       GRAS  196 vkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291 
                 ++p E+l+V++  +  +l+des++  +  +rd+vL+ +++++P+v+++   +  ++++ F +rf e l ++sa fd l+a++pr+seer+ vEr ++g
  462855272 1164 IDPAEVLVVSSLCHFRHLMDESAAPGQlsPRDQVLNNIRKMRPDVFIHGVMNGRYSTTYFPTRFRELLFFFSAQFDLLDATVPRDSEERMLVERDIFG 1261
                 *********************998777779******************************************************************** PP

       GRAS  292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 
                 +++ nv+aceg++r+er et+++W++r ++aG++++pls +++k +   +++ + + + v+e++ +l+  Wk+r L+++S W
  462855272 1262 QAALNVIACEGTDRVERPETYKQWQARNHRAGLRQLPLSPEVVKVVLDKVKNNYHKDFIVDEDQRWLLHRWKGRVLYALSTW 1343
                 ******************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.392341764IPR005202Transcription factor GRAS
PfamPF035146.5E-48367546IPR005202Transcription factor GRAS
PfamPF035141.4E-50547765IPR005202Transcription factor GRAS
PROSITE profilePS5098559.849451324IPR005202Transcription factor GRAS
PfamPF035147.8E-1029721343IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 1353 aa     Download sequence    Send to blast
MDTKSEEFQG QGVLLAEPFS PSIFLDLPPT PRPDSNGEDL ASSDDLVLPF ISRMLMEEDI  60
EDEFYYHYPD HPALLQAQQT YAQILSDDAT TSASSDSATT NTDRSGTFTL SPSSCDASFS  120
NATWPYNPVE LSQLLQSTPY PNTGVGLNSF IAGDANRRGS IHENDEATAL CKEDSVGIQS  180
SGFLNGAGKE TDAVITKLAA GAGGRMHGVV TSGQNMVNMD MLNQAFLMGM EEAKKFLPPN  240
NILLMDPEST SREHRPRDSG LFQGIAAGQL KEDEVVDKLL KFQGSVYVRG RKNRRNWDDL  300
EAEMGKNNKM MVPEPEETGD VVDKMIIHGY AMCLEKMKSL SITMGDEAEK NARKGNERQS  360
SYEAVDLRTL LIHCAQAVSM DDRRSATELL VQIKQHSSPR GDANQRLAHY FAVGLEARLA  420
GTGSQVYKSL MTKHTSVVEF LKACQLYLAA CCFEMTAFRF SNMTICKAVV GRKKVHIVDY  480
GVQYGFQWPS LLAFFSTWEG GPPEVRITGI DLPQPGFRPA SRVEETGRRL SNCAHQFGVP  540
FKFHGIAEVR ITGIDLPQPG FRPASRVEET GRRLSNCAHL FGVPFKFHGI AAKWDAISVD  600
DLDIDPDEVL IINSIIQFGN LMDEGVYIHS PSPRDVVLNN IQKMRPDMFI LCVVNGSYGV  660
PFFVTRFREA LFYYSAMFDM LDATSPRDNE QRLLIEREII GRYAMNVIAC EGFDRADRPE  720
TYKQWQVRNH RAGLRQLPLY PDIVKILREK VKNQYHKDFV IDEEDIGENN FFYQYPDHPV  780
LLQAQLPFAQ ILSDATTTSN SSSASPDSPD TDSTFAGGRV SSDSDHSDMA SAGFVKPFSP  840
ANDRDMFTSA FLKGMEEANK FLPTNKLDRG FTMEEAQVDG MFGHGRGRKN KHGGIDDLDV  900
KEHRASKLIM TETEDAAAHQ MYDEMMLHEQ DICMKGVQHL SISTETESAK GSGKKARWRR  960
QTSGSDDVVD LQTLLLHCAQ AVATDDRRSA HELLRKIKQH ASSSGDGVQR LAYCFAEGLE  1020
ARLAGTGSQL YQSLMVRRTS VVDFLKAYKL FMAACCCKKV AFTFSNKTIH DAMAGRTRLH  1080
IVDYGLNYGF QWPGLLRGLA AREGGPPEVR ITGIDLPQPG FRPAYQIEET GRQLSKCARE  1140
FGVPFRFHGI AAKRETIRPE DLNIDPAEVL VVSSLCHFRH LMDESAAPGQ LSPRDQVLNN  1200
IRKMRPDVFI HGVMNGRYST TYFPTRFREL LFFFSAQFDL LDATVPRDSE ERMLVERDIF  1260
GQAALNVIAC EGTDRVERPE TYKQWQARNH RAGLRQLPLS PEVVKVVLDK VKNNYHKDFI  1320
VDEDQRWLLH RWKGRVLYAL STWVAAGDAS SGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4237113438374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462924.10.0hypothetical protein SORBIDRAFT_02g034550
TrEMBLA0A0E0MIE40.0A0A0E0MIE4_ORYPU; Uncharacterized protein
STRINGSb02g034550.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-134GRAS family protein