PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462855269
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 557aa    MW: 62108.8 Da    PI: 6.5628
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462855269genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS1241.8e-3820834711153
       GRAS  11 avssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegee 110
                +++++d + a+ lL++++e+asp+gd++qRla +f+++L+arla+++ ++y++l++++ts    +e l a+klf  ++ + k+++  aN++I +a+ g +
  462855269 208 CFTAHDRTSADLLLKQIKEHASPTGDATQRLAYCFAQGLEARLAGTGRQVYRSLSANRTS---IVEFLEAYKLFMSTCCFRKVAFAFANKTIFDAAMGRS 304
                6789999***********************************************999998...9************************************ PP

       GRAS 111 rvHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg 153
                ++Hi+D+++ +G+QWp Ll+ L +R++gpp++RiT ++ p++ 
  462855269 305 KLHILDYGLHYGFQWPELLRLLGARDGGPPEVRITSIDLPQTA 347
                *************************************998865 PP

2GRAS137.21.7e-42358543189373
       GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                +  ++L+++p+Eal+Vn  ++  +l+ e+  ++s  +rd vL+ + +++P+v++    + ++ +++Fl rf eal  +salfd+l+a++pre++ r ++E
  462855269 358 ICAKDLNMEPDEALVVNDLFNFRTLMGENIVIDStsPRDVVLNNITKMKPNVFIQGIVNGSY-GTTFLSRFREALFDHSALFDMLDATMPRENQLRLVIE 456
                56789***********************998887779************************9.679********************************** PP

       GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                r ++g+ + n++aceg++r+er et+++W+ r ++aG++++pl+ +++k a  ++++++ + + +ee +++l++gWk+r L++ S W
  462855269 457 RDIFGWVALNAIACEGEDRVERGETYKQWQVRNQRAGLRQLPLNREIVKMATDIVKNHYHKNFIIEEGQQWLLQGWKGRILLAHSTW 543
                ***********************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.64172524IPR005202Transcription factor GRAS
PfamPF035146.3E-36208347IPR005202Transcription factor GRAS
PfamPF035146.0E-40358543IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MSPPFVFPDL AAAPDVGARV ATSSYIARIC LLMEEEDVHE EHPDYPALLH AQQPFAQILS  60
SASLPDHAAA ADALPTDTID NPDMFTAVFF KGVEEARKFL PADTGCKLVS GGQLKDKSGD  120
KVRRDRHGAG HEELEAQVGR TSKMPNAELE EAGARDLFDE MMLRGYDVCS KVVGGLRVDV  180
DKDDAAKESK KTTRKKNRAR WLTCTLCCFT AHDRTSADLL LKQIKEHASP TGDATQRLAY  240
CFAQGLEARL AGTGRQVYRS LSANRTSIVE FLEAYKLFMS TCCFRKVAFA FANKTIFDAA  300
MGRSKLHILD YGLHYGFQWP ELLRLLGARD GGPPEVRITS IDLPQTATVP ASLVCHSICA  360
KDLNMEPDEA LVVNDLFNFR TLMGENIVID STSPRDVVLN NITKMKPNVF IQGIVNGSYG  420
TTFLSRFREA LFDHSALFDM LDATMPRENQ LRLVIERDIF GWVALNAIAC EGEDRVERGE  480
TYKQWQVRNQ RAGLRQLPLN REIVKMATDI VKNHYHKNFI IEEGQQWLLQ GWKGRILLAH  540
STWVADDSCS GSTKLSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-332025439374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663691.10.0PREDICTED: scarecrow-like protein 14
TrEMBLJ3NAH50.0J3NAH5_ORYBR; Uncharacterized protein
STRINGOB11G28110.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-111SCARECROW-like 14