PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462855147
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 558aa    MW: 62533.1 Da    PI: 8.0048
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462855147genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS369.64.1e-1131785491373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL++cA+av+++d + a++lL++++++asp+gd +qRla++f+e+L+arla+++s +y++l +++ts    +  l+a++l+  +  + k++++  N 
  462855147 178 LRTLLIHCAQAVATDDRRSATELLKQIKQHASPQGDGTQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---AVALLQAYQLYMAAICFKKVAFIFSNY 274
                6789************************************************************999998...899************************ PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                +I++a+ g++++Hi+D++i++G+QWp++l+ +a+R++gpp++RiTg++ p++g   +e++eetg+rL ++A+e+gvpf++n+++a+++e+++ e+L+++p
  462855147 275 TIYNAALGKKKIHIVDYGIQYGFQWPCFLRRIANREGGPPEVRITGIDLPQPGfrPTERIEETGRRLGNYAREFGVPFKYNAIAASKMESVRKEDLKIDP 374
                ****************************************************9*********************************************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                +E+l+Vn+ +q ++l+desv +es+rd vL+ +++++P+ ++++  + + +++ F++rf eal yysalfd l+++ pr+s++r+ +E+ ++gr++ nv+
  462855147 375 DEVLIVNCLYQFKNLMDESVVIESPRDVVLNNIRKMRPHTFIHAIVNGSFSAPFFVTRFREALFYYSALFDVLDTTTPRDSDQRMLIEQNIFGRAALNVI 474
                **************************************************************************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                aceg++r+er et+++W+ r ++aG+k++pl++++++ +++ ++ ++ + + ++ ++++l++gWk+r L+++S W
  462855147 475 ACEGTDRVERPETYKQWQVRNQRAGLKQLPLNSEIMQVVRTKVKDCYHKDFVIDVDHNWLLQGWKGRILYAISTW 549
                ***********************************************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.144152530IPR005202Transcription factor GRAS
PfamPF035141.4E-110178549IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MLMEDDIEDK FVYDYPDNPT LLQAQQPFLD ILSNSDDTTT TTSTTSGSSA HHGVGGNKLA  60
VRSAGFPAPA PPVVRSVKQE AVDAVPGVGR GRKNPYADEE LEIEGGRSSK QSALQGDDDA  120
TRDMLDRVMM PSHESCLLQM QQLRIAMEEE AAKNEAANGK AGNGKAKGRR GGREVVDLRT  180
LLIHCAQAVA TDDRRSATEL LKQIKQHASP QGDGTQRLAH CFAEGLQARL AGTGSMVYQS  240
LMAKRTSAVA LLQAYQLYMA AICFKKVAFI FSNYTIYNAA LGKKKIHIVD YGIQYGFQWP  300
CFLRRIANRE GGPPEVRITG IDLPQPGFRP TERIEETGRR LGNYAREFGV PFKYNAIAAS  360
KMESVRKEDL KIDPDEVLIV NCLYQFKNLM DESVVIESPR DVVLNNIRKM RPHTFIHAIV  420
NGSFSAPFFV TRFREALFYY SALFDVLDTT TPRDSDQRML IEQNIFGRAA LNVIACEGTD  480
RVERPETYKQ WQVRNQRAGL KQLPLNSEIM QVVRTKVKDC YHKDFVIDVD HNWLLQGWKG  540
RILYAISTWV ANDAGSYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-451825498374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
SwissprotO809331e-171SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0E0FDC60.0A0A0E0FDC6_9ORYZ; Uncharacterized protein
STRINGORGLA12G0145700.10.0(Oryza glaberrima)
STRINGORGLA12G0207400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-157GRAS family protein