PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462854319
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 646aa    MW: 72445.8 Da    PI: 6.4707
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462854319genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS337.42.6e-1032526161365
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++ L++cA+av++gdl+ a+++L+++++++sp+gd++qR+a++f+e+L+arla+++s +y++l +++ts   +++ l+a++lf  ++ + k +h    +
  462854319 252 LRTMLIHCAQAVATGDLRSANEMLKQIKQHSSPRGDATQRMAHCFAEGLEARLAGTGSLVYQSLVSKRTS---VVDFLKAYQLFMAATCFKKAQHTFSSR 348
                5789*************************************************************99999...*************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                +Il+av+g +++Hi+ +++++G+QWp+Ll+ La R++gpp++R Tg++ p++g   + +le+tgerL++ A++++vpf+f++ +a+++e+++ ++L+++p
  462854319 349 TILDAVAGRSKLHIVEYGVQHGFQWPTLLHFLAGREGGPPEVRFTGIDLPQPGfrPAYQLEKTGERLSNCARQFRVPFKFHA-IATKWETVTAQDLNIDP 447
                ****************************************************9999**************************.7**************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                +E+l+Vn+     +l+desv ++s  +rd vL+ +++++P+v+v++  +   +++ Fl+rf eal +ysa fd+l+a++pr+++ r  +E+ l+gr++ n
  462854319 448 DEVLVVNCECFFDKLMDESVLVDSpsPRDVVLRNIRNMRPNVFVHSVVNGTFGAPFFLTRFREALFFYSAHFDMLDATIPRDNDVRLLIEQDLIGRSALN 547
                *******************98887779************************************************************************* PP

       GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                v+acega+r+ r et+++W+ r ++aG++++pls ++++ ++  +r+++ + + ++e++ +l++gWk+r
  462854319 548 VIACEGADRVDRPETYKQWQVRNNRAGLRQLPLSPEVVNLVRGKVRNYYHKDFLLDEDHRWLLQGWKGR 616
                *************************************************889***************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.298226605IPR005202Transcription factor GRAS
PfamPF035149.0E-101252616IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 646 aa     Download sequence    Send to blast
MGVGLDDFGA DDLSAVLLPA QDGATPGFQQ SPLPVNSDGA SFAGEAVQSS VYLGGAKEEQ  60
DGTKANITTL SSVDEDHGAL ASAFFGGHRG VNMDMLNRAF AQGMEEAKKF LPANNALFID  120
LEAPITGERL STDSKPKGGL MTRQVKEEET VADEMPTMFR ESSNGRGRKN RHHDEDLEAE  180
TGRSSKQMMQ EEQEETGAQE MYREIMSCSY EEFVKRMEDL RVAMDSESEK TSRRGSRKGA  240
RGRQLADEVV DLRTMLIHCA QAVATGDLRS ANEMLKQIKQ HSSPRGDATQ RMAHCFAEGL  300
EARLAGTGSL VYQSLVSKRT SVVDFLKAYQ LFMAATCFKK AQHTFSSRTI LDAVAGRSKL  360
HIVEYGVQHG FQWPTLLHFL AGREGGPPEV RFTGIDLPQP GFRPAYQLEK TGERLSNCAR  420
QFRVPFKFHA IATKWETVTA QDLNIDPDEV LVVNCECFFD KLMDESVLVD SPSPRDVVLR  480
NIRNMRPNVF VHSVVNGTFG APFFLTRFRE ALFFYSAHFD MLDATIPRDN DVRLLIEQDL  540
IGRSALNVIA CEGADRVDRP ETYKQWQVRN NRAGLRQLPL SPEVVNLVRG KVRNYYHKDF  600
LLDEDHRWLL QGWKGRICST KNFVPREREK NLTVHPFAIC SNDRSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-352565818329GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980079.10.0PREDICTED: scarecrow-like protein 34
TrEMBLK3ZHD30.0K3ZHD3_SETIT; Uncharacterized protein
STRINGSi025985m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-147SCARECROW-like 14