PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462854304
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 2039aa    MW: 231521 Da    PI: 7.0672
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462854304genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS316.55.6e-972045723373
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                +lL++cA+av+++++  a +lL++++++as +gd+ qRla++f+e+L+arl++++++l +   +++ s   ++e l+a+k+f  ++ + k++ +    +I
  462854304 204 TLLIHCAQAVAANNHMIAIELLKQIKQNASTTGDARQRLAQCFAEGLEARLSGTGNQLWNLHMAERPS---VVEFLKAYKTFMAACCFNKVAVMFSVMTI 300
                68***************************************************999999766665555...9**************************** PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                ++a+ g++r+Hi+D+++++G+QW+ L++ La+R++g+p+l+iT+++ +++    +++++e g+ L+k A+e+g+pf+f+  +++++e++++e+L+++ +E
  462854304 301 MDAIVGKKRLHIVDYGMNYGFQWAGLIRWLAERNGGQPELKITAIACSQHMfcPAQKIKEQGRWLSKCASEFGLPFKFHS-ITTEWEKVSIEDLNTDVDE 399
                ***********************************************99889****************************.6999*************** PP

       GRAS 201 alaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                +l+Vn  ++  +l+des+s ++  +rd+vL+ +++++P+v++ +  ++ + ++sFl rf ea+ yy+alfd+++a++prese r ++E+ ++gr++ n++
  462854304 400 VLIVNDLFNFRSLMDESLSFDNqsPRDTVLNNIRKMRPDVFIQSIVNCTY-GSSFLSRFREAMFYYTALFDMFDATMPRESESRLVLEQSWFGRHVLNII 498
                ******************9988779*************************.679********************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                acega+ + r e++++W+ r ++aG+k++pl+  ++k  k   +k+++d ++v e+ ++l++gW++r L++ SaW
  462854304 499 ACEGADLVDRPEKYRQWQVRNQRAGLKQLPLKPCIVKVLKDKAKKHHKD-FMVCEDGQWLLQGWMGRILFAHSAW 572
                ***********************************************77.************************* PP

2GRAS375e-12577643306373
       GRAS 306 rerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                + r e++++W+ r ++aG+k++pl+ +++k  k  ++k+++d ++v e+ ++l++gW++r L++ SaW
  462854304 577 VDRPEKYRQWQVRNQRAGLKQLPLKPDMVKVLKDKVKKHHKD-FMVCEDGQWLLQGWMGRILFAHSAW 643
                6899************************************77.************************* PP

3GRAS136.43e-428251034155373
       GRAS  155 keeleetgerLakfAeelgvp.fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh.ns 250 
                 +  +eetg++L+  A++lgvp f+f++++a +++d++++  + +++ +++Vn+v++l++l+d+sv+               +P+ v ++   ++   +
  462854304  825 ASYIEETGRQLSACARKLGVPfFKFHAIAAANWDDVRVD-VQDDQETVVVVNSVFRLETLVDDSVAGGR-----------PRPRDVGLAAGVVNGfYD 910 
                 66789***************9459****999*****664.44555667899**********99888877...........556666666666666689 PP

       GRAS  251 esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sd 347 
                 +sFl rf eal  ysa+fd l+a++pr+s++r+++Er +l++ ++n+vaceg++r+ r+ ++++W+ r+++aG++++pl++++++ ++ +++k +  +
  462854304  911 SSFLSRFREALFNYSAIFDVLDATMPRTSRHRRVLERDVLAPCAMNIVACEGRDRTDRCDSYRQWHLRMQRAGLRQLPLDSDIVAAVRDMVKKQQyHK 1008
                 9********************************************************************************************99999 PP

       GRAS  348 gyrveeesgslvlgWkdrpLvsvSaW 373 
                  + ++e++ +l++gWk+r L++ S W
  462854304 1009 DFVIDEDRRWLLQGWKGRILYANSTW 1034
                 9************************* PP

4GRAS297.63.2e-91118315512373
       GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99  
                  +lL++cA+av+++++  a +lL++++e+as +gd+ qRla++f+++L+arl++++++l   l +++ s   ++e l+a+k+f  ++ + k++ +   
  462854304 1183 STLLIRCAQAVAANNHVSAIELLKQIKEHASATGDARQRLAQCFAKGLEARLVGTGNQLWTLLMAERPS---VVEFLKAYKMFTAACSFNKVAVIFSV 1277
                 579********************************************************9988888887...9************************* PP

       GRAS  100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197 
                  +I++a+ g++r+Hi+D+++ +G+QW+ L++ La+ ++g p+l+iT+vg ++      +ee g+rL+k A+e+g+pf+f++++++r+e++++e+L+ +
  462854304 1278 MTIMDAIVGKRRLHIVDYGMHYGFQWAGLIRWLAEGNGGRPELKITAVGCSHDMFCPGIEEQGRRLSKCASEFGLPFKFRFITTDRWEKVSIEDLNRE 1375
                 **************************************************8777999***************************************** PP

       GRAS  198 pgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293 
                  +E+l+Vn  ++  +l+des+  ++  +rd+vL  +++++P+v++ +  + ++ ++sFl rf eal yy++lfd ++a++prese r  +E++l+g +
  462854304 1376 GDEVLIVNDLFSFRSLMDESLFFDNpsPRDTVLGNIRKMRPDVFIQSIVNRSY-GSSFLSRFREALFYYTSLFDIFDATMPRESESRLLLEQALFGHR 1472
                 ********************98777669*****************99999999.679***************************************** PP

       GRAS  294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 
                 + n+vacega+   r e++++W+ r ++aGF+++pl+  + +  k  ++k+++d +++ e+ ++l++gW++r L++ SaW
  462854304 1473 VLNIVACEGADLLDRPEKYRQWQVRNQRAGFRQLPLKPGIIQVLKDKVKKHHKD-FMLGEDGQWLLQGWMGRILFAHSAW 1551
                 ****************************************************77.************************* PP

5GRAS40.44.3e-1317301787157
       GRAS    1 lvelLlecAeavssgdlelaqalLarlselas.pdgdpmqRlaayfteALaarlarsv 57  
                 l++lL++cAe v+++d + a++lLa++ ++as p+gd++qRla++f+ AL+arla+s+
  462854304 1730 LRTLLIRCAEKVKDDDRRGARELLAHITHHASpPSGDATQRLAHCFAAALEARLAGSQ 1787
                 6789**************************661678*******************955 PP

6GRAS137.41.6e-4217892031124374
       GRAS  124 QWpaLlqaLasRp.egppslRiTgvgspesg..skeeleetgerLakfAeelgvp.fefnvlvakrledleleeLrvkp..gEalaVnlvlqlhrlld 215 
                 Q p+L+  La+ + ++pp++ iTg+++p++g   +  +eetg++L+  A+elgvp f+f+++++ +++d++  + + +   + +l+Vn+v+++++l+d
  462854304 1789 QLPPLM--LAAGDgGPPPEVTITGIDHPQPGfrPASYIEETGRQLTACARELGVPcFKFHAIASANWDDVRSFDPEDDDdpETVLVVNSVFRMETLVD 1884
                 666666..4444437788**************99********************98*****9999***996655544435466789************ PP

       GRAS  216 esvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhet 311 
                 +sv ++   +rd vL ++++++P v+++   +  + ++sFl rf eal yysa+fd l+a++p++ ++r+ +Ere             g++r+ r  +
  462854304 1885 DSVVVDRpsPRDVVLGAIRRMRPAVFTHGVVNGFY-GASFLSRFREALFYYSAMFDVLDATMPST-QHRRALERE-------------GRDRTDRFDS 1967
                 **87776669********************99999.789**********************9776.566667776.............9********* PP

       GRAS  312 lekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374 
                 +++W+ r+++aG+ ++pl  + ++ ++ ++rk    + + +++++++l++gWk+r L++ S W+
  462854304 1968 YRQWQLRMQRAGLAQLPLHRDDVAAVRDMVRKQRyHKDFVIDQDRHWLLQGWKGRILYANSTWT 2031
                 *******************************9998999*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.756176554IPR005202Transcription factor GRAS
PfamPF035142.0E-94204572IPR005202Transcription factor GRAS
PfamPF035141.7E-9577643IPR005202Transcription factor GRAS
PROSITE profilePS5098519.5116391014IPR005202Transcription factor GRAS
PfamPF035141.0E-398251034IPR005202Transcription factor GRAS
PROSITE profilePS5098553.35611561533IPR005202Transcription factor GRAS
PfamPF035141.1E-8811831551IPR005202Transcription factor GRAS
PfamPF035141.5E-1017301787IPR005202Transcription factor GRAS
PROSITE profilePS5098515.09617852010IPR005202Transcription factor GRAS
PfamPF035145.4E-4017892031IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 2039 aa     Download sequence    Send to blast
MVPPSILNMF MEDEIGGELL YQRSNYPALL QVQQPLVQIL SSPSFTTRNY NTGNTEENKD  60
LLPGGSDDQS TLSAPFFKGV DVAGAFLKGV EEAIRFLPSD NNIRRDYLVT EIFSESRNLK  120
AIKKRYNRDN YLEDEARRTR KTMLMMIEEP EEVGIHEILE EMMLRGYETC IKEMEKLQIA  180
LNNEGKSKTR GGSKTTRDVV DLPTLLIHCA QAVAANNHMI AIELLKQIKQ NASTTGDARQ  240
RLAQCFAEGL EARLSGTGNQ LWNLHMAERP SVVEFLKAYK TFMAACCFNK VAVMFSVMTI  300
MDAIVGKKRL HIVDYGMNYG FQWAGLIRWL AERNGGQPEL KITAIACSQH MFCPAQKIKE  360
QGRWLSKCAS EFGLPFKFHS ITTEWEKVSI EDLNTDVDEV LIVNDLFNFR SLMDESLSFD  420
NQSPRDTVLN NIRKMRPDVF IQSIVNCTYG SSFLSRFREA MFYYTALFDM FDATMPRESE  480
SRLVLEQSWF GRHVLNIIAC EGADLVDRPE KYRQWQVRNQ RAGLKQLPLK PCIVKVLKDK  540
AKKHHKDFMV CEDGQWLLQG WMGRILFAHS AWGADLVDRP EKYRQWQVRN QRAGLKQLPL  600
KPDMVKVLKD KVKKHHKDFM VCEDGQWLLQ GWMGRILFAH SAWSLAHIIA SSSSSSVNNG  660
ASTKLYMVDK AHSSVHEGAE VEEAEDNWSN MVNLSFLMGT VEARKLLPST DNSRLVFIAG  720
DVDNVRLMKK DWKGVQNELE AGSRASKLMA TAAPEEEAAV LQEMVKRMML NDCAVSREEM  780
EDLRAAMKDG DGSPLRPTSS KLLQPVVDLR TLLIRCAEKP GFRPASYIEE TGRQLSACAR  840
KLGVPFFKFH AIAAANWDDV RVDVQDDQET VVVVNSVFRL ETLVDDSVAG GRPRPRDVGL  900
AAGVVNGFYD SSFLSRFREA LFNYSAIFDV LDATMPRTSR HRRVLERDVL APCAMNIVAC  960
EGRDRTDRCD SYRQWHLRMQ RAGLRQLPLD SDIVAAVRDM VKKQQYHKDF VIDEDRRWLL  1020
QGWKGRILYA NSTWSNLKGG KDLLLGGSGD QSLLSSPFSD GADVVGAFLK GVEEAIRFLP  1080
RDSRFGRGDL VNEIFRESRN KKRCDRDDYY LEEEVRRTSK SMVMMTEEPK EIGVHEILDE  1140
LMLRGYETYI KEMENLRIAL NNESKKNKPR AGSKAASDVV DLSTLLIRCA QAVAANNHVS  1200
AIELLKQIKE HASATGDARQ RLAQCFAKGL EARLVGTGNQ LWTLLMAERP SVVEFLKAYK  1260
MFTAACSFNK VAVIFSVMTI MDAIVGKRRL HIVDYGMHYG FQWAGLIRWL AEGNGGRPEL  1320
KITAVGCSHD MFCPGIEEQG RRLSKCASEF GLPFKFRFIT TDRWEKVSIE DLNREGDEVL  1380
IVNDLFSFRS LMDESLFFDN PSPRDTVLGN IRKMRPDVFI QSIVNRSYGS SFLSRFREAL  1440
FYYTSLFDIF DATMPRESES RLLLEQALFG HRVLNIVACE GADLLDRPEK YRQWQVRNQR  1500
AGFRQLPLKP GIIQVLKDKV KKHHKDFMLG EDGQWLLQGW MGRILFAHSA WVVAEYISRM  1560
LMEEEEDDRF DQPGLMEAQQ SLAHIIASSS CSSATKPYAA AEVEEAEYNS WSAMVNMSFL  1620
MGTVEARKLL PATTDNILLS GDVDSVRLIQ RSRKGGNIEE LEAGSRARKV MATAAPEEEA  1680
AVLQEMVKGM MLNDCEVSRE EMEYLRGAMT TNDGDGSWPR KVLQPVVVDL RTLLIRCAEK  1740
VKDDDRRGAR ELLAHITHHA SPPSGDATQR LAHCFAAALE ARLAGSQIQL PPLMLAAGDG  1800
GPPPEVTITG IDHPQPGFRP ASYIEETGRQ LTACARELGV PCFKFHAIAS ANWDDVRSFD  1860
PEDDDDPETV LVVNSVFRME TLVDDSVVVD RPSPRDVVLG AIRRMRPAVF THGVVNGFYG  1920
ASFLSRFREA LFYYSAMFDV LDATMPSTQH RRALEREGRD RTDRFDSYRQ WQLRMQRAGL  1980
AQLPLHRDDV AAVRDMVRKQ RYHKDFVIDQ DRHWLLQGWK GRILYANSTW TSVPHHHHP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3020615518374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978278.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3YDM30.0K3YDM3_SETIT; Uncharacterized protein
STRINGSi012328m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-109GRAS family protein