PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462854301
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family GRAS
Protein Properties Length: 2321aa    MW: 260674 Da    PI: 6.876
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462854301genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS44.42.7e-14291271369
       GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                l+a +pr++++r  vEr l+gr i+n++aceg++r+er et+++W++r ++a +k++pl++ ++k    l+   +++     + +  +v+gWk+r L++
  462854301   2 LDAIAPRDNDQRLLVERDLFGRCIMNLIACEGSDRVERPETYKQWQMRNHRARLKQLPLDSGVVK----LVGDKANE-----QFRTDFVIGWKGRILYA 91 
                78899******************************************************998765....33333323.....33445777777777775 PP

2GRAS325.88.6e-1004247931370
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lL++cA+a+s +d + a++lL +++++ sp+gd++qRla+ f+ +L+arla+++se+yk+l +++ts   ++e l+a +l+  ++ +   ++   N 
  462854301 424 LRTLLIHCAQAMSMDDRRSATELLVQIKQHTSPRGDANQRLAHLFAVGLEARLAGMGSEVYKSLMTKHTS---VVEFLKACQLYLAACCFEMTAFRFSNM 520
                6789***************************************************************999...*************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                +I +a++  ++vHi+D+++++G+QW +Ll  +a+ ++gpp++RiTg++ p++g   + ++eetg+rL++ A+ +gvpf+f+  +a +++++++++L+++p
  462854301 521 TICKAIADRKKVHIVDYGVQYGFQWSSLLAHFATWEGGPPEVRITGIDLPQPGfrPASRVEETGRRLSNCAHLFGVPFKFHG-IAAKWDAISVDDLDIDP 619
                ****************************************************9*9***************************.799************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                +E+l++n+++q  +l+de v ++s  +rd vL+ +++++P+v++++  + +++ + F++rf eal yysa+fd+l+a++pr++e+r +vEre++gr ++n
  462854301 620 DEVLIINSIMQFGNLMDEGVYMHSpsPRDVVLNNIQKMRPDVFILCVVNGSYGVPFFVTRFREALFYYSAMFDMLDATVPRDNEQRLVVEREIIGRYAMN 719
                *******************99998889************************************************************************* PP

       GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                v+aceg +r er et+++W+ r ++aG++++pl  +++k  +  +++ + + + ++ +++++++gWk+r L+++
  462854301 720 VIACEGLDRAERPETYKQWQVRNHRAGLRQLPLYPDIVKILREKVKNQYHKDFVIDVDHNWFLQGWKGRILYAI 793
                *************************************************888*******************986 PP

3GRAS339.55.8e-10499613672373
       GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99  
                  +lLl+cA+a++++d ++a++lL +++++asp+gd +qRla +f+e+L+arla+++s+ly++l +++ts   +++ l+a+klf  ++ + k+++   N
  462854301  996 HTLLLHCAQAMAADDCRNAHELLRKIKQHASPSGDGVQRLAYCFAEGLEARLAGTGSQLYQSLMVRRTS---VVDFLKAYKLFMAACCCKKVAFTFSN 1090
                 679*****************************************************************9...************************** PP

       GRAS  100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195 
                 ++I +a+ g +r+Hi+D+++++G+QWp Ll+ La+R++gpp++RiTg++ p++g   + ++eetg+rL+k A+e+gvpf+f+  +a + e++++e+L+
  462854301 1091 KTIHDAMTGRTRLHIVDYGLNYGFQWPGLLRGLAAREGGPPEVRITGIDLPQPGfhPAYQIEETGRRLSKCAQEFGVPFRFHG-IAAKRETIRPEDLN 1187
                 *****************************************************99999*************************.69999********* PP

       GRAS  196 vkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291 
                 ++p E+l+V++  +  +l+des++  +  +rd+vL+ +++++P+v+++   +  ++++ F +rf e l ++sa fd l+a++pr+seer+ vEr ++g
  462854301 1188 IDPAEVLVVSSLCHFRHLMDESAAPGQlsPRDQVLNNIQKMRPDVFIHGVMNGGYGTTYFPTRFRELLFFFSAQFDLLDATVPRDSEERMLVERDIFG 1285
                 *********************998777779******************************************************************** PP

       GRAS  292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 
                 +++ nv+aceg++r+er et+++W++r ++aG+k+++ls +++k +   +++ + + + v+e++ +l+  Wk+r L+++S W
  462854301 1286 QAALNVIACEGTDRVERPETYKQWQARNHRAGLKQLALSPEVVKVVLDKVKNNYHKDFIVDEDQRWLLHRWKGRVLYALSTW 1367
                 ******************************************************888************************* PP

4GRAS1992.9e-61148817252240
       GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99  
                  +lLl+cA+av++ d + a  lL++++e+asp gd++qRla +f+++L+arla+++ ++y++l++++ts    +e l a+k+f  ++ + k+++  aN
  462854301 1488 HTLLLHCAKAVTD-DRTSAGLLLKQIKEHASPMGDATQRLAYCFAQGLEARLAGTGRQVYRSLSANRTS---IVEFLEAYKMFMSTCCFRKVAFAFAN 1581
                 679********98.78899********************************************999998...9************************* PP

       GRAS  100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195 
                 ++I +a+ g +++Hi+D+++ +G+QWp Ll+ L +R++gpp++RiT ++ p++g   ++ + e+g+rL+k A+e+gvpf+f++ +   +e++  e+L+
  462854301 1582 KTIFDAAMGRSKLHILDYGLHYGFQWPELLRLLGARDGGPPEVRITSIDLPQTGfrPANHMAEMGHRLSKCAREFGVPFKFHP-MLAPWETVCAEDLN 1678
                 *****************************************************9*9***************************.799*********** PP

       GRAS  196 vkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvv 240 
                 v+p+Eal+Vn  ++  +l+des  ++s  +rd vL+ + +++P+ v+
  462854301 1679 VEPDEALVVNDLFNFRTLMDESIVIDStsPRDVVLNNITKMKPNAVT 1725
                 **********************99888779**************998 PP

5GRAS305.51.3e-931726208315373
       GRAS   15 gdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeerv 112 
                 +d + a  lL++++e+asp gd++qRla +f+++L+arla+++ ++y++l++++ts    +e l a+klf  ++ + k+++  aN++I +a+ g +++
  462854301 1726 DDRTSAGLLLKQIKEHASPMGDATQRLAYCFAQGLEARLAGTGRQVYRSLSANRTS---IVEFLEAYKLFMSTCCFRKVAFAFANKTIFDAAMGRSKL 1820
                 56778999******************************************999998...9************************************** PP

       GRAS  113 HiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvl 208 
                 Hi+D+++ +G+QWp Ll+ L +R++gpp++RiT ++ p++g   ++ + e+g+rL+k A+e+gvpf+f++ +   +e++  e+L+v+p+Eal+Vn  +
  462854301 1821 HILDYGLHYGFQWPELLRLLGARDGGPPEVRITSIDLPQTGfrPANHMAEMGHRLSKCAREFGVPFKFHP-MLAPWETVCAEDLNVEPDEALVVNDLF 1917
                 ****************************************9*9***************************.799************************ PP

       GRAS  209 qlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegae 304 
                 +  +l+des  ++s  +rd vL+ + +++P+v++    + ++ +++Fl rf eal  +salfd+l+a++pre++ r ++Er ++g+ + n++aceg++
  462854301 1918 NFRTLMDESIVIDStsPRDVVLNNITKMKPNVFIQGIVNGSY-GTTFLSRFREALFDHSALFDMLDATMPRENQLRLVIERDIFGWVALNAIACEGED 2014
                 *********99888779************************9.679**************************************************** PP

       GRAS  305 rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 
                 r+e  et+++W+ r ++aG++++pl+ +++k a  ++++++ + +++ee +++l++gWk+r L++ S W
  462854301 2015 RVECGETYKQWQVRNQQAGLRKLPLNREIVKMATDIVKNHYHKNFMIEEGQQWLLQGWKGRILLAHSTW 2083
                 *****************************************999************************* PP

6GRAS29.11.3e-0922752319347
       GRAS    3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfte 47  
                 +lL++cA+av+++++  a +lL++++++as +gd+ qRla++f+e
  462854301 2275 TLLIHCAQAVAANNHMIAIELLKQIKQNASTTGDARQRLAQCFAE 2319
                 68*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098512.894185IPR005202Transcription factor GRAS
PfamPF035149.5E-12291IPR005202Transcription factor GRAS
PROSITE profilePS5098557.515398777IPR005202Transcription factor GRAS
PfamPF035143.0E-97424793IPR005202Transcription factor GRAS
PROSITE profilePS5098559.7849691348IPR005202Transcription factor GRAS
PfamPF035142.0E-1019961367IPR005202Transcription factor GRAS
PROSITE profilePS5098531.75714611688IPR005202Transcription factor GRAS
PfamPF035141.0E-5814881725IPR005202Transcription factor GRAS
PROSITE profilePS5098552.26616862064IPR005202Transcription factor GRAS
PfamPF035144.5E-9117262083IPR005202Transcription factor GRAS
PROSITE profilePS5098510.79222472321IPR005202Transcription factor GRAS
PfamPF035144.3E-722752319IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 2321 aa     Download sequence    Send to blast
MLDAIAPRDN DQRLLVERDL FGRCIMNLIA CEGSDRVERP ETYKQWQMRN HRARLKQLPL  60
DSGVVKLVGD KANEQFRTDF VIGWKGRILY AIDGEDLASS ADLVLPFISR MLMEEDIEDE  120
FFYHYPDHPV LLQAQQTYAQ ILSDDSTTSA SSDSATTNTD KSGVFTLLPS SCDASFSNAT  180
WPYNPVELSQ LLLSTPYPNT GVGVNSFIAG DANRRGSIHE NADEATALCK EDRMGIQSSG  240
FLNEAGKDTD AVITNLAAGA GGGMHGVVTS AFFSGQNLVN MDMLNQSFLM GMEEAKKFLP  300
PNNILLMDPR STSTEQRPRD SNLFQGIAAG QLKEDKLLKF QGSVYGRGRK NRRNWDDLEA  360
EMGKNKMMVP EPEETGDVVD KMIIHGYAMC LEKMKSLSII MSDEAEKNAR KGDGKQSSYE  420
AVDLRTLLIH CAQAMSMDDR RSATELLVQI KQHTSPRGDA NQRLAHLFAV GLEARLAGMG  480
SEVYKSLMTK HTSVVEFLKA CQLYLAACCF EMTAFRFSNM TICKAIADRK KVHIVDYGVQ  540
YGFQWSSLLA HFATWEGGPP EVRITGIDLP QPGFRPASRV EETGRRLSNC AHLFGVPFKF  600
HGIAAKWDAI SVDDLDIDPD EVLIINSIMQ FGNLMDEGVY MHSPSPRDVV LNNIQKMRPD  660
VFILCVVNGS YGVPFFVTRF REALFYYSAM FDMLDATVPR DNEQRLVVER EIIGRYAMNV  720
IACEGLDRAE RPETYKQWQV RNHRAGLRQL PLYPDIVKIL REKVKNQYHK DFVIDVDHNW  780
FLQGWKGRIL YAIPSPLPTI GICSPRHFSA QILSDATTTS NSSASPDSPD TESTFAGGGV  840
NSDSDHSGMA SSGFVKPLSP AGDWDMFTSA FVKGMEEANK FLPTNSALAD HKLDRGFSIE  900
KEQVDGMLGH GRGRKNKHGC NDDLDVKEHR ASKLIMMETE DAAARQMFDE MMLHEQDICM  960
KGVQHLSIST ERAKGSGKKA RGRRQTSGSE DVVDLHTLLL HCAQAMAADD CRNAHELLRK  1020
IKQHASPSGD GVQRLAYCFA EGLEARLAGT GSQLYQSLMV RRTSVVDFLK AYKLFMAACC  1080
CKKVAFTFSN KTIHDAMTGR TRLHIVDYGL NYGFQWPGLL RGLAAREGGP PEVRITGIDL  1140
PQPGFHPAYQ IEETGRRLSK CAQEFGVPFR FHGIAAKRET IRPEDLNIDP AEVLVVSSLC  1200
HFRHLMDESA APGQLSPRDQ VLNNIQKMRP DVFIHGVMNG GYGTTYFPTR FRELLFFFSA  1260
QFDLLDATVP RDSEERMLVE RDIFGQAALN VIACEGTDRV ERPETYKQWQ ARNHRAGLKQ  1320
LALSPEVVKV VLDKVKNNYH KDFIVDEDQR WLLHRWKGRV LYALSTWGVE EASKFLPADT  1380
GCKLVSGGQL KDKSGDKVRR GRHGAGHEEL EAQVGRTSKM STAELEEAGA RDLFDEMMLR  1440
GYDVCSKGVG GLRIDVDKDD AAKESKKTTR KKNRARWERR GTKVVDLHTL LLHCAKAVTD  1500
DRTSAGLLLK QIKEHASPMG DATQRLAYCF AQGLEARLAG TGRQVYRSLS ANRTSIVEFL  1560
EAYKMFMSTC CFRKVAFAFA NKTIFDAAMG RSKLHILDYG LHYGFQWPEL LRLLGARDGG  1620
PPEVRITSID LPQTGFRPAN HMAEMGHRLS KCAREFGVPF KFHPMLAPWE TVCAEDLNVE  1680
PDEALVVNDL FNFRTLMDES IVIDSTSPRD VVLNNITKMK PNAVTDDRTS AGLLLKQIKE  1740
HASPMGDATQ RLAYCFAQGL EARLAGTGRQ VYRSLSANRT SIVEFLEAYK LFMSTCCFRK  1800
VAFAFANKTI FDAAMGRSKL HILDYGLHYG FQWPELLRLL GARDGGPPEV RITSIDLPQT  1860
GFRPANHMAE MGHRLSKCAR EFGVPFKFHP MLAPWETVCA EDLNVEPDEA LVVNDLFNFR  1920
TLMDESIVID STSPRDVVLN NITKMKPNVF IQGIVNGSYG TTFLSRFREA LFDHSALFDM  1980
LDATMPRENQ LRLVIERDIF GWVALNAIAC EGEDRVECGE TYKQWQVRNQ QAGLRKLPLN  2040
REIVKMATDI VKNHYHKNFM IEEGQQWLLQ GWKGRILLAH STWDEIGGEL LYQRSNYPAL  2100
LQVQQPLVQI LSSPSFTTRN YNTGNTEENK DLLPGGSDDQ STLSAPFFKG VDVAGAFLKG  2160
VEEAIRFLPS DNNIRRDYLV TEIFSESRNL KAIKKRYNRD NYLEDEARRT RKTMLMMIEE  2220
PEEVGIHEIL EEMMLRGYET CIKEMEKLQI ALNNEGKSKT RGGSKTTRDV VDLPTLLIHC  2280
AQAVAANNHM IAIELLKQIK QNASTTGDAR QRLAQCFAED P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4142820834374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462924.10.0hypothetical protein SORBIDRAFT_02g034550
TrEMBLA0A0E0MIE40.0A0A0E0MIE4_ORYPU; Uncharacterized protein
STRINGSb02g034550.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-140GRAS family protein