PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462853072
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 215aa    MW: 22818.7 Da    PI: 7.8886
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462853072genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26034.46.2e-111646131
     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfa 31
               +CaaCk +rrkCa+dC+lapyfpa+ +++ a
  462853072 16 RCAACKNQRRKCAQDCILAPYFPASGANRGA 46
               6***********************9887755 PP

2DUF260119.12.5e-37541541101
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk +rrkCa+dC+lapyfpa++p+++a+v+++FGasn+ ++l++lp ++r +a+++++ eA+ r++dPvyG++gvi +lq +++ +++ela+++++
  462853072  54 RCAACKNQRRKCAQDCILAPYFPASDPQRYACVQRIFGASNIARMLQSLPVHDRGKAADTMATEAHRRVQDPVYGCAGVIARLQDEIRAVQSELARTEAQ 153
                6**********************************************************************************************99987 PP

     DUF260 101 l 101
                +
  462853072 154 I 154
                5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.9E-91646IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089124.00953154IPR004883Lateral organ boundaries, LOB
PfamPF031958.1E-3754151IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MSTSDNTAVA ANQGGRCAAC KNQRRKCAQD CILAPYFPAS GANRGAVAAN PGRRCAACKN  60
QRRKCAQDCI LAPYFPASDP QRYACVQRIF GASNIARMLQ SLPVHDRGKA ADTMATEAHR  120
RVQDPVYGCA GVIARLQDEI RAVQSELART EAQIAVHAAA AAGAQPEAGN QLNAQLVQGP  180
MQQQGDSLMV QEPFPGLDGL LDDVHAGATL FDDNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-32521689125LOB family transfactor Ramosa2.1
5ly0_B3e-32521689125LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap462853072
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025806770.19e-69LOB domain-containing protein 24-like
SwissprotP594671e-38LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594681e-38LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A3L6TJP85e-68A0A3L6TJP8_PANMI; Uncharacterized protein
STRINGPavir.J09684.1.p2e-62(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.15e-38LOB domain-containing protein 24