PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462852566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 298aa    MW: 31468.7 Da    PI: 7.8039
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462852566genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26061.32.5e-1968113146
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46 
                +CaaCk+lrr+C+++C++apyf  ++p+kfa+vhk+FGasnv+k+l
  462852566  68 PCAACKLLRRRCSQECPFAPYFSPHEPHKFAAVHKVFGASNVSKML 113
                7*******************************************98 PP

2DUF260114.38.2e-361162088100
     DUF260   8 lrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                lrr+C+++C++apyf  ++p+kfa+vhk+FGasnv+k+l ++pe er da+sslvyeA+ r+rdPvyG++g i+ lqqq+++l+ael+++++e
  462852566 116 LRRRCSQECPFAPYFSPHEPHKFAAVHKVFGASNVSKMLLEVPEAERADAASSLVYEANLRLRDPVYGCMGAISVLQQQVNSLEAELDAIRAE 208
                89*************************************************************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031955.3E-1968113IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089121.318108209IPR004883Lateral organ boundaries, LOB
PfamPF031956.6E-36116206IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MQQALSNNSA CWASTRDRLD EIGKKIKREP AAAGISALAA SASTAPAENP VPRRLGLGLG  60
GALNTVIPCA ACKLLRRRCS QECPFAPYFS PHEPHKFAAV HKVFGASNVS KMLLLLRRRC  120
SQECPFAPYF SPHEPHKFAA VHKVFGASNV SKMLLEVPEA ERADAASSLV YEANLRLRDP  180
VYGCMGAISV LQQQVNSLEA ELDAIRAEIF KHRYHQPGAT GAAGLVDDAA QARASFDVAP  240
GTPMHAGADV VSVVGAAGQE ASTVAGAPGM PPSSAVYIAE AAEQPSSTTD HHYSSLNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-3711521217114LOB family transfactor Ramosa2.1
5ly0_B2e-3711521217114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap462852566
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1219191e-114AK121919.1 Oryza sativa Japonica Group cDNA clone:J033106D14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970407.11e-103LOB domain-containing protein 15
SwissprotQ9AT613e-57LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A1E5VHX51e-107A0A1E5VHX5_9POAL; LOB domain-containing protein 15
STRINGSi004575m1e-108(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.12e-55LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]