PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462852566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 298aa    MW: 31468.7 Da    PI: 7.8039
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462852566genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26061.32.5e-1968113146
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46 
                +CaaCk+lrr+C+++C++apyf  ++p+kfa+vhk+FGasnv+k+l
  462852566  68 PCAACKLLRRRCSQECPFAPYFSPHEPHKFAAVHKVFGASNVSKML 113
                7*******************************************98 PP

2DUF260114.38.2e-361162088100
     DUF260   8 lrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                lrr+C+++C++apyf  ++p+kfa+vhk+FGasnv+k+l ++pe er da+sslvyeA+ r+rdPvyG++g i+ lqqq+++l+ael+++++e
  462852566 116 LRRRCSQECPFAPYFSPHEPHKFAAVHKVFGASNVSKMLLEVPEAERADAASSLVYEANLRLRDPVYGCMGAISVLQQQVNSLEAELDAIRAE 208
                89*************************************************************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031955.3E-1968113IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089121.318108209IPR004883Lateral organ boundaries, LOB
PfamPF031956.6E-36116206IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MQQALSNNSA CWASTRDRLD EIGKKIKREP AAAGISALAA SASTAPAENP VPRRLGLGLG  60
GALNTVIPCA ACKLLRRRCS QECPFAPYFS PHEPHKFAAV HKVFGASNVS KMLLLLRRRC  120
SQECPFAPYF SPHEPHKFAA VHKVFGASNV SKMLLEVPEA ERADAASSLV YEANLRLRDP  180
VYGCMGAISV LQQQVNSLEA ELDAIRAEIF KHRYHQPGAT GAAGLVDDAA QARASFDVAP  240
GTPMHAGADV VSVVGAAGQE ASTVAGAPGM PPSSAVYIAE AAEQPSSTTD HHYSSLNS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1219191e-114AK121919.1 Oryza sativa Japonica Group cDNA clone:J033106D14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970407.11e-104PREDICTED: LOB domain-containing protein 15-like
SwissprotQ9AT612e-58LBD13_ARATH; LOB domain-containing protein 13
TrEMBLK3XRN11e-108K3XRN1_SETIT; Uncharacterized protein
STRINGSi004575m1e-108(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.12e-55LOB domain-containing protein 13