PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462851050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 346aa    MW: 36583.6 Da    PI: 10.3408
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462851050genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26066.84.9e-214389147
     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47
               +CaaCk+lrr+Ca++Cv+apyfp ++p+kfanvhk+FGasnv+kll+
  462851050 43 PCAACKLLRRRCAAGCVFAPYFPPAEPHKFANVHKVFGASNVSKLLQ 89
               7********************************************98 PP

2DUF2601247.8e-392443441100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeq.pkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                +CaaCk+ rr+C++dCv+apyf + + +++fa +h++FGa +v kll+++p ++r da+sslvyeA+ar+rdPvyG+v+ i++lqqq+e+l+a+lal+++
  462851050 244 PCAACKMYRRRCPEDCVFAPYFTSPKaARDFADLHRVFGAGHVRKLLQEIPVQHRGDAVSSLVYEANARVRDPVYGCVAAISSLQQQVETLQAQLALAQA 343
                7*********************9977589********************************************************************998 PP

     DUF260 100 e 100
                e
  462851050 344 E 344
                6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.90542144IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-204390IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089123.376243345IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-38244342IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MHNCRNRTLG RPTQQRVRRL RQNPLPWKTR FARSSPPASA AAPCAACKLL RRRCAAGCVF  60
APYFPPAEPH KFANVHKVFG ASNVSKLLQV SALPSSVSSN LPLPVPGAAS ARKPGASQPT  120
CTHSWGAASQ APSSASAKHI SGEGERCGRH VHSFVSFQSL FLAMTETAAA AVADGASWGA  180
ASQAPSSASA KHISGEGERC GRHVHSFVSF QSLFLAMTET AAAAVADGAR SGVHGAGGGR  240
AATPCAACKM YRRRCPEDCV FAPYFTSPKA ARDFADLHRV FGAGHVRKLL QEIPVQHRGD  300
AVSSLVYEAN ARVRDPVYGC VAAISSLQQQ VETLQAQLAL AQAEMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-35403468112LOB family transfactor Ramosa2.1
5ly0_B2e-35403468112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap462851050
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0699112e-72BT069911.1 Zea mays full-length cDNA clone ZM_BFb0321D10 mRNA, complete cds.
GenBankKJ7276502e-72KJ727650.1 Zea mays clone pUT5577 LOB transcription factor (LOB19) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020203399.11e-47LOB domain-containing protein 4-like
STRINGLus100406384e-47(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.13e-37LOB domain-containing protein 4