PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462850820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MIKC_MADS
Protein Properties Length: 320aa    MW: 35581.4 Da    PI: 10.1175
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462850820genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.81.8e-201055247
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
               +ien   r vtf kRr+g+lKKA ELSvLC a+v viif s gkl+
  462850820 10 QIENPVHRRVTFFKRREGLLKKARELSVLCSADVGVIIFPSLGKLK 55
               79*****************************************996 PP

2SRF-TF64.21.4e-2082128248
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
     SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 
                +ien   r vtf kRr+g+lKKA ELSvLC a+v viif s gk+ e
  462850820  82 QIENPVHRRVTFFKRREGLLKKARELSVLCSADVGVIIFPSLGKVTE 128
                79******************************************987 PP

3K-box22.16.2e-091281941884
      K-box  18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                ++e++ L++ei  Lq+ +R   G +  +  l  L+ Le+ L+  + + Rs+K+ +l++  e lq+k 
  462850820 128 EHEVSLLREEIGLLQQGLRSTFGGGAADVRLDRLHALEKGLQLWIYQTRSTKEYILRSANEILQQKG 194
                689*************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.1E-22161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.605154IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.19E-21157IPR002100Transcription factor, MADS-box
PfamPF003195.0E-191154IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.67573128IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-2373132IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-2173129IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-197595IPR002100Transcription factor, MADS-box
PfamPF003193.1E-1983128IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-1995110IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-19110131IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.126124218IPR002487Transcription factor, K-box
PfamPF014862.6E-7128194IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MVRGKVRMQQ IENPVHRRVT FFKRREGLLK KARELSVLCS ADVGVIIFPS LGKLKFHQGQ  60
SKGRSSAGTQ KTMVRGKVRM QQIENPVHRR VTFFKRREGL LKKARELSVL CSADVGVIIF  120
PSLGKVTEHE VSLLREEIGL LQQGLRSTFG GGAADVRLDR LHALEKGLQL WIYQTRSTKE  180
YILRSANEIL QQKGYYDEQR RREAPGRGRS EQREEDEEED RGDERVLDGG GEDGEEDERE  240
LQKQRSPSPG ERACQHDSHG VGGLGGEEVP QPDALTLRIL PLRQGPAPIA VAVAVAARRS  300
AGDRQAGPAR AEGGECGRVG
Cis-element ? help Back to Top
SourceLink
PlantRegMap462850820
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D3HSH05e-53A0A0D3HSH0_9ORYZ; Uncharacterized protein
STRINGOBART12G05930.18e-54(Oryza barthii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.13e-24AGAMOUS-like 12