PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10028688m
Common NameEUTSA_v10028688mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 420aa    MW: 46280.9 Da    PI: 5.6791
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10028688mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.15.9e-16220273356
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                      ++k+ rr+ +NRe+ArrsR+RK++++  Le+ v eL++e ++L  +l++++ ++
  Thhalv10028688m 220 DVKKSRRMLSNRESARRSRRRKQEQTSDLETQVNELKGEHSSLLRQLSNMNHKY 273
                      789**************************************9998887777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-19218282IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.0E-12219272No hitNo description
PROSITE profilePS5021711.185220274IPR004827Basic-leucine zipper domain
PfamPF001703.6E-14220274IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.84E-12221272No hitNo description
PROSITE patternPS000360225240IPR004827Basic-leucine zipper domain
PfamPF124988.7E-13289384IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002240Biological Processresponse to molecule of oomycetes origin
GO:0009626Biological Processplant-type hypersensitive response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MNSIFSIDDF SDPFWEAPPP LNSNPAKVVT AEEVSQSQSE WTFEMFLEEI SSSVSSEPVG  60
NNNAIVGVSS AQSLPSVSGQ NDFEEDSRFR RDRHDRDSGN RDYAPPPSTV IVHSDDYHRV  120
LKNKLETECA TVVALRTGSV KPEDSSTSPE TQFQPAQSSP LAQGSLMTPG ELGVSSSSPA  180
ELKKTGVLAK QVTSGSSREY SDDDDLDEEN ETTGSLKPED VKKSRRMLSN RESARRSRRR  240
KQEQTSDLET QVNELKGEHS SLLRQLSNMN HKYDDAAVGN RILKADIETL RAKVKMAEET  300
VKRVTGMNPM LLGRSNGHSN NNRMPLTGNN RMDSSCIPAF QPQSNLNHLP NPNIGIPAIL  360
PPRLGNNFVA PPSLNSQTNS QLQRIRNSQN HHVAPTSTNP YGWNTEPQND SAWPKKCVD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1234241RRSRRRKQ
2236241SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3535460.0AK353546.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-51-H19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006396478.10.0hypothetical protein EUTSA_v10028688mg
SwissprotO227630.0BZP10_ARATH; Basic leucine zipper 10
TrEMBLE4MYE90.0E4MYE9_EUTHA; mRNA, clone: RTFL01-51-H19
TrEMBLV4MZ690.0V4MZ69_EUTSA; Uncharacterized protein
STRINGAT4G02640.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148711720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02640.20.0bZIP family protein