PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10027479m
Common NameEUTSA_v10027479mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 278aa    MW: 31588 Da    PI: 7.4628
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10027479mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.34.1e-55111361128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      +ppGfrFhPtdeel+++yLk+kv+++ +++ ++i  vd++kvePwd+p+k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++
  Thhalv10027479m  11 VPPGFRFHPTDEELITHYLKPKVSNTFFSA-TAIGVVDLNKVEPWDIPRKAKMGEKEWYFFCVRDRKYPTGLRTNRATETGYWKATGKDKEIFK 103
                      69*************************999.88***************99999***************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++lvg+kktLvfykgrapkg+k+dWvmheyrl
  Thhalv10027479m 104 -GKSLVGMKKTLVFYKGRAPKGVKSDWVMHEYRL 136
                      .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-629161IPR003441NAC domain
PROSITE profilePS5100558.88211161IPR003441NAC domain
PfamPF023656.4E-3012136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
EIVEDGKQID VPPGFRFHPT DEELITHYLK PKVSNTFFSA TAIGVVDLNK VEPWDIPRKA  60
KMGEKEWYFF CVRDRKYPTG LRTNRATETG YWKATGKDKE IFKGKSLVGM KKTLVFYKGR  120
APKGVKSDWV MHEYRLDGKH SIQNLSQIAK NEWVICRIYQ KRADGTKVDF SGLMMLDSHI  180
NRIEPIDLPS LMDCSQRDSF PGSSTHVTCF SDQETEDKRL IQESKDGSGS PVCNDLMFLQ  240
DNYSLKKLLL NGQESQVPGI DPSGLAGTVE LDCFWNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-54816714171NO APICAL MERISTEM PROTEIN
1ut4_B2e-54816714171NO APICAL MERISTEM PROTEIN
1ut7_A2e-54816714171NO APICAL MERISTEM PROTEIN
1ut7_B2e-54816714171NO APICAL MERISTEM PROTEIN
3swm_A2e-54816717174NAC domain-containing protein 19
3swm_B2e-54816717174NAC domain-containing protein 19
3swm_C2e-54816717174NAC domain-containing protein 19
3swm_D2e-54816717174NAC domain-containing protein 19
3swp_A2e-54816717174NAC domain-containing protein 19
3swp_B2e-54816717174NAC domain-containing protein 19
3swp_C2e-54816717174NAC domain-containing protein 19
3swp_D2e-54816717174NAC domain-containing protein 19
4dul_A2e-54816714171NAC domain-containing protein 19
4dul_B2e-54816714171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382760.0KF738276.1 Brassica napus NAC transcription factor 92 (NAC92.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006414110.10.0hypothetical protein EUTSA_v10027479mg, partial
SwissprotQ9FKA01e-165NAC92_ARATH; NAC domain-containing protein 92
TrEMBLV4MQZ20.0V4MQZ2_EUTSA; Uncharacterized protein (Fragment)
STRINGfgenesh2_kg.7__3461__AT5G39610.11e-168(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39610.11e-166NAC domain containing protein 6