PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10026078m
Common NameEUTSA_v10026078mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family GeBP
Protein Properties Length: 250aa    MW: 27948.3 Da    PI: 4.8374
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10026078mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573781.5e-24142204264
           DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkK 64 
                      lfqrlw+eeDei+lLqG+ d++a++g sp+ d+d+fye + ksisf++sk+q+ +Ki  LKk+
  Thhalv10026078m 142 LFQRLWTEEDEISLLQGMNDYEADKGYSPYVDMDGFYELALKSISFQASKKQFRDKISFLKKR 204
                      79***********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.0E-17143204IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MAKKLNPLED PPTSSSSDEE EVETLSREEE EEEEEVEEEI SDDSSSEEED ELMSPVKIPS  60
RKKPKPPSAA VTIAVPGRLS ITSGSESSPS KPTEKEVRGS PAIKSGKKRP DEKNSTEVSA  120
KRARKVSEET EKQIVEATKK PLFQRLWTEE DEISLLQGMN DYEADKGYSP YVDMDGFYEL  180
ALKSISFQAS KKQFRDKISF LKKRRLTLCE RWALSLLKHL KNKALGIYRF IGFNGEGEAK  240
PLSSNLGIS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1190205KKQFRDKISFLKKRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006414884.11e-178hypothetical protein EUTSA_v10026078mg
TrEMBLV4MLB71e-178V4MLB7_EUTSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.12e-28DNA-binding storekeeper protein-related transcriptional regulator