PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10026007m
Common NameEUTSA_v10026007mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 263aa    MW: 28619.7 Da    PI: 5.988
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10026007mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.29.8e-1092138551
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                      k e+r   NReA r++R++Kka+ + Le++v  L a N++L k+l++
  Thhalv10026007m  92 KGEKRPLGNREAVRKYREKKKAKAASLEDEVSRLRAVNQQLVKRLQS 138
                      6799999***********************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.4E-1188155IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.87590156IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-1391156No hitNo description
SuperFamilySSF579592.35E-792139No hitNo description
PfamPF077161.4E-1492145IPR004827Basic-leucine zipper domain
CDDcd146862.53E-1294147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MEDGELDFSN QEVFSSSDMG ELPPSNCSID SFFEGLLMDS HQAACTHTHT CNPTGPENTH  60
THTCFHVHTK ILPEDSDEKV STDDTAESCG KKGEKRPLGN REAVRKYREK KKAKAASLED  120
EVSRLRAVNQ QLVKRLQSQA TLEAEVSRLK CLLVDLRGRI DGEIGSFPYQ KPMAANIPSF  180
SHMMNPCNVQ CDDEVYCLQN GFGGNSQEGA SINDQGLSGC ELDQLQCIAN QNFVGNGNGS  240
FHNATASASN KRKGGHRAPK AV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0001600.0BT000160.1 Arabidopsis thaliana putative protein (At4g35040) mRNA, complete cds.
GenBankAY0723860.0AY072386.1 Arabidopsis thaliana putative protein (At4g35040) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412160.10.0hypothetical protein EUTSA_v10026007mg
SwissprotQ8VY761e-172BZP19_ARATH; Basic leucine zipper 19
TrEMBLV4MLL20.0V4MLL2_EUTSA; Uncharacterized protein
STRINGAT4G35040.11e-170(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.11e-167bZIP family protein