PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10025957m
Common NameEUTSA_v10025957mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NZZ/SPL
Protein Properties Length: 276aa    MW: 30292.7 Da    PI: 9.029
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10025957mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NOZZLE185.25.7e-5711401149
           NOZZLE   1 matslffmstdqnsvrnpnellrntrlvvnssgeirte.tkksrgrkpgsktaqqkqkkptlrgmgvaklerfiieeekkklvvatvgdtssva 93 
                      matslff+ tdqn   npnel rnt+ v n sgeirte ++k+rgrkpgskt+qq+qkkp  rgmg+a+ler +ie ekkk +va+ gdts   
  Thhalv10025957m   1 MATSLFFIPTDQN---NPNELQRNTHHV-NGSGEIRTEpQQKTRGRKPGSKTGQQNQKKPKRRGMGMAQLERIRIEGEKKKTAVAGGGDTS--- 87 
                      9***********9...9**********9.*********778**************************************************... PP

           NOZZLE  94 aisntatrlpvpvdrgvvlqgfps.......slgssrilcggvgsgqvmidpvispwgfvets 149
                           +trlp   d+gvvlqgfps       s  +sr++cggvgsgq+mi+    pwgfvet 
  Thhalv10025957m  88 ---AITTRLP---DPGVVLQGFPSyggpttaSSFGSRLYCGGVGSGQIMIE----PWGFVETP 140
                      ...3479***...***********999988755569*************97....6*****96 PP

2NOZZLE2118.2e-65141275169314
           NOZZLE 169 nnrcdtcf.kkkrldgdqnnvvrsngggfskytmipppmngydeyllqsdhhqrsqgflydqriaraasvsaasasinpyfneatnltgsreef 261
                      n r dtcf kkkrldgd++nvvrsngggfskytmipppmngyd+ ll++d  qr qgf+yd+r+ar+a  sa+  s  pyf eatn+tg  +ef
  Thhalv10025957m 141 NIRYDTCFiKKKRLDGDDQNVVRSNGGGFSKYTMIPPPMNGYDH-LLPPD--QRNQGFFYDHRLARSA--SAS--SNHPYFHEATNHTGLLDEF 227
                      7799***97899*******************************9.*****..***************9..555..458**************** PP

           NOZZLE 262 gsvlegnprngsrgvkeyeffpgkydervskvakvaslvgdcspn..tidlslkl 314
                       s    nprng++ vkeyeffp kyde  s    va++vgdcspn  tidlslkl
  Thhalv10025957m 228 ESG---NPRNGTGDVKEYEFFPRKYDETDS----VATSVGDCSPNisTIDLSLKL 275
                      996...*********************887....689*****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF087449.0E-1133275IPR014855Plant transcription factor NOZZLE
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MATSLFFIPT DQNNPNELQR NTHHVNGSGE IRTEPQQKTR GRKPGSKTGQ QNQKKPKRRG  60
MGMAQLERIR IEGEKKKTAV AGGGDTSAIT TRLPDPGVVL QGFPSYGGPT TASSFGSRLY  120
CGGVGSGQIM IEPWGFVETP NIRYDTCFIK KKRLDGDDQN VVRSNGGGFS KYTMIPPPMN  180
GYDHLLPPDQ RNQGFFYDHR LARSASASSN HPYFHEATNH TGLLDEFESG NPRNGTGDVK  240
EYEFFPRKYD ETDSVATSVG DCSPNISTID LSLKL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1592554e-39AF159255.1 Arabidopsis thaliana sporocyteless (SPL) mRNA, complete cds.
GenBankDQ6532274e-39DQ653227.1 Arabidopsis thaliana clone 0000017356_0000012141 unknown mRNA.
GenBankDQ4468734e-39DQ446873.1 Arabidopsis thaliana clone pENTR221-At4g27330 sporocyteless (At4g27330) mRNA, complete cds.
GenBankAB4937044e-39AB493704.1 Arabidopsis thaliana At4g27330 mRNA for hypothetical protein, partial cds, clone: RAAt4g27330.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006413089.10.0hypothetical protein EUTSA_v10025957mg
SwissprotO818361e-111SPL_ARATH; Protein SPOROCYTELESS
TrEMBLV4MGZ80.0V4MGZ8_EUTSA; Uncharacterized protein
STRINGAT4G27330.11e-109(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134351828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27330.11e-112sporocyteless (SPL)