PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10025918m
Common NameEUTSA_v10025918mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family BES1
Protein Properties Length: 286aa    MW: 30885.6 Da    PI: 8.402
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10025918mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822208.81.4e-6421351146
           DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspessl 94 
                      ++++r+ptwkErEnnkrRERrRRaiaaki++GLR +Gn+klpk++DnneVlkALc+eAGw+vedDGttyrkg+kp++++e ++ s+sasp+ss+
  Thhalv10025918m   2 TSGTRTPTWKERENNKRRERRRRAIAAKIFSGLRIHGNFKLPKHCDNNEVLKALCNEAGWTVEDDGTTYRKGCKPMDRMELMNGSTSASPCSSY 95 
                      5899****************************************************************************************** PP

           DUF822  95 qsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslv 146
                      q        +sp+ sy++sp+sssfpsp++    +  +a+sl+p+l++ls+ 
  Thhalv10025918m  96 Q--------PSPRGSYNPSPSSSSFPSPTN----PFGDANSLIPWLKNLSSN 135
                      *........*******************98....56677899****999763 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.9E-603132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MTSGTRTPTW KERENNKRRE RRRRAIAAKI FSGLRIHGNF KLPKHCDNNE VLKALCNEAG  60
WTVEDDGTTY RKGCKPMDRM ELMNGSTSAS PCSSYQPSPR GSYNPSPSSS SFPSPTNPFG  120
DANSLIPWLK NLSSNSPSKL PFFHGSSISA PVTPPLARSP TRDQVTTITD SGWLSGMQTP  180
QSGPSSPTFS LVSRNPFFDK EAFKMGDCNS PMWTPGQSGN CSPAIPAGVD QNSDVPMADG  240
MAAEFAFGCN AIAAVGMVKP WEGERIHGEC VSDDLELTLG TSRTR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00444DAPTransfer from AT4G18890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0245120.0BT024512.1 Arabidopsis thaliana At4g18890 mRNA, complete cds.
GenBankAY0883790.0AY088379.1 Arabidopsis thaliana clone 6321 mRNA, complete sequence.
GenBankAK1188500.0AK118850.1 Arabidopsis thaliana At4g18890 mRNA for unknown protein, complete cds, clone: RAFL21-18-A16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006414043.10.0hypothetical protein EUTSA_v10025918mg
SwissprotO494041e-178BEH3_ARATH; BES1/BZR1 homolog protein 3
TrEMBLV4P7F80.0V4P7F8_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.7__2404__AT4G18890.11e-176(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18890.11e-159BES1/BZR1 homolog 3