PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10025465m
Common NameEUTSA_v10025465mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family TCP
Protein Properties Length: 380aa    MW: 41785.3 Da    PI: 8.1041
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10025465mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP125.46.3e-39481832136
              TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaa 95 
                       g+kdrhsk+ T++g+RdRRvRls+++a +f+dLqd+LG+d++sk++eWL+++a+ +i el+++ ++++   +++++++++ +  ++++ +++a
  Thhalv10025465m  48 SGGKDRHSKVWTSKGPRDRRVRLSVSTALQFYDLQDRLGYDQPSKAVEWLIKAAEDSISELPSL-NNTNFPITDDENQNQTLTGAAANSLSKSA 140
                      689*************************************************************.44443446666666666666667777777 PP

              TCP  96 .kskksqksaasalnlak.esrakarararertrekmriknkl 136
                       +s++++++++s l+l++ e r kar+rarert+++ + ++++
  Thhalv10025465m 141 cSSNSDTSKNSSGLSLSRsELRDKARERARERTAKETKERDHN 183
                      6888888888999****99****************99988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.0E-3649179IPR005333Transcription factor, TCP
PROSITE profilePS5136931.22950108IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.205159180IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:1903508Biological Processpositive regulation of nucleic acid-templated transcription
GO:2000306Biological Processpositive regulation of photomorphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MFPKIGDDEM IGDLMKNNNG DVVDNNNNNR LSRWHHNSSR IIRVSRASGG KDRHSKVWTS  60
KGPRDRRVRL SVSTALQFYD LQDRLGYDQP SKAVEWLIKA AEDSISELPS LNNTNFPITD  120
DENQNQTLTG AAANSLSKSA CSSNSDTSKN SSGLSLSRSE LRDKARERAR ERTAKETKER  180
DHNTNSHTTS FTDLLNSGSD PVNTNRQWMA PSSSPAPAQM EYFSSGLILG SGQTHFPIQT  240
NSHPFSSISD HHHHHHPHQE FSFVPDHLIS PAGSNGGGAF NLDFNMSTSS GAGTAVASAG  300
FSGFNRGTLQ SNSTNHHHHH NQSFLANLQR FPSSEGGGPQ FLFGALPAEN HHPHNHNHQF  360
QLYYENGSRN SDQKGKGKN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A6e-2455109155Putative transcription factor PCF6
5zkt_B6e-2455109155Putative transcription factor PCF6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). Participates in ovule develpment (PubMed:25378179). Promotes light-regulated transcription of CHS, CAB, HYH and HY5. Regulates positively photomorphogenesis (e.g. hypocotyl elongation inhibition and cotyledon opening in response to blue light) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179, ECO:0000269|PubMed:26596765}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00006PBMTransfer from 493022Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10025465m
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the miRNA miR-JAW (PubMed:12931144). Induced by blue light. Stabilized by light but labile in darkness due to proteasome-dependent proteolysis (at protein level) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:26596765}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3527970.0AK352797.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-07-O21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006414109.10.0transcription factor TCP2
RefseqXP_024005115.10.0transcription factor TCP2
SwissprotQ93V430.0TCP2_ARATH; Transcription factor TCP2
TrEMBLV4MJI10.0V4MJI1_EUTSA; Uncharacterized protein
STRINGXP_006414109.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM76152539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18390.21e-128TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2
Publications ? help Back to Top
  1. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  2. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]