PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10025126m
Common NameEUTSA_v10025126mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family WRKY
Protein Properties Length: 467aa    MW: 51105.9 Da    PI: 6.217
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10025126mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY81.21.1e-25170226259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       DgynWrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ ++v+ei+++g H he
  Thhalv10025126m 170 PDGYNWRKYGQKQVKSPKGSRSYYRCTYSDCCAKK-IECSNDSGNVIEIVNKGLHSHE 226
                      5********************************98.*********************8 PP

2WRKY95.15.1e-30332388359
                      -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      Dgy+WrKYGqK+vkg+ +pr+YYrCtsagCpv+k++e++ e++++v+itY++ Hnh+
  Thhalv10025126m 332 DGYRWRKYGQKMVKGNSNPRNYYRCTSAGCPVRKHIETAVENKTAVIITYKEVHNHD 388
                      9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-19166228IPR003657WRKY domain
SuperFamilySSF1182904.84E-20167228IPR003657WRKY domain
SMARTSM007741.1E-23169227IPR003657WRKY domain
PROSITE profilePS5081116.272171228IPR003657WRKY domain
PfamPF031064.3E-17171225IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.7E-31315390IPR003657WRKY domain
PROSITE profilePS5081130.4325390IPR003657WRKY domain
SuperFamilySSF1182906.41E-26326390IPR003657WRKY domain
SMARTSM007741.6E-32330389IPR003657WRKY domain
PfamPF031061.7E-22332388IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MEEKGSEAEV YAVETDKSEK VEPEKELCND GLSQLRDEES FGVTDADKED LHDESVRDTL  60
AKDQVEGARE NSAVEPNGED VKEAKEKDSG KENVVSAIMP VDKVSAENRE VETSPGLAVS  120
PDPSMVDPSS AQGDAQGLSL VSVPTKQEQK PDSCVVNNLL VSPVLRTPAP DGYNWRKYGQ  180
KQVKSPKGSR SYYRCTYSDC CAKKIECSND SGNVIEIVNK GLHSHEPPRK SSFSLREIRA  240
ASAITPVSED NKVVRETASV PSGSDPSVSS KENICQTIIE RKRHFENEAV EEPEPKRRLK  300
KDNSQSSDFV SKPGKKHKVV VHAAGDVGIS GDGYRWRKYG QKMVKGNSNP RNYYRCTSAG  360
CPVRKHIETA VENKTAVIIT YKEVHNHDMP VPKKRHGPPS SMLVAAAAPT SMRTRSDDQV  420
NIPTSSQCSV GRENEKQSSE ALDVGGEKVM ESARTLLSIG FEIKQC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A9e-23318390274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534110.0AK353411.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-30-K05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412655.10.0hypothetical protein EUTSA_v10025126mg
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLV4MMR70.0V4MMR7_EUTSA; Uncharacterized protein
STRINGAT4G30935.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32