PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10024895m
Common NameEUTSA_v10024895mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 530aa    MW: 58407.6 Da    PI: 7.226
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10024895mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.67.1e-10387445563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +  l++++
  Thhalv10024895m 387 KRVKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQLTLLQRDMMGLTNQN 445
                      899******************************************99998877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-19383447IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.76385448IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.61E-11387443No hitNo description
PfamPF001701.1E-8387444IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-11387444No hitNo description
CDDcd147031.56E-23388437No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MGDTEKCNTD MIQRLHSSFG TSSSSIPKQP ISLNQQLEIP QLNPNFMRSA QFPQFSQPFS  60
DSGKRIPSRI PPTSPYSQIP TTRQQPGSQS FNPGATHSRS LSQPSSFFSF DSLPPLSPSP  120
FRDHDVSMED RDSGGFNNNP SLLPPSPFTR CNSTSSRVVA AGESLPPRKS HRRSNSDIPT  180
GFNSSSMPPR PLERSISGGE CADWSKTTPF VKKESSCERE GAGDREAMDD LFSAYMNLEN  240
IDVLNSSEAD DSKNGNENRD DMESSRASGT KTNGSDTEGE SSSVNESGNH NNKRRAGGVD  300
IAPTSRHYRS VSVDSCFMEK LSFGDDSLKP PPSPGTVSRK VSPTNSVDAN QGAAFSIEFK  360
NGEFTAAEMK KIMANDKLAE MAMSDPKRVK RILANRQSAA RSKERKMRYI VELEHKVQTL  420
QTEATTLSAQ LTLLQRDMMG LTNQNNELKF RLQAMEQQAR LRDALNEALN GEVQRLKLAV  480
GETSHNESDR SKMQSLNAEM FQQLNISQLR QQPQQNQNGT MSTKPESSE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411679.10.0hypothetical protein EUTSA_v10024895mg
TrEMBLV4MD770.0V4MD77_EUTSA; Uncharacterized protein
STRINGAT4G38900.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.30.0bZIP family protein