PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10024708m
Common NameEUTSA_v10024708mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family CPP
Protein Properties Length: 606aa    MW: 64496.2 Da    PI: 8.0463
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10024708mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.61.4e-14132172142
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                      ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e+
  Thhalv10024708m 132 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVEN 172
                      589**************************.********9875 PP

2TCR50.63.7e-16217255139
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN 
  Thhalv10024708m 217 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNF 255
                      589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-16132172IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.427133257IPR005172CRC domain
PfamPF036387.6E-11134169IPR005172CRC domain
SMARTSM011144.4E-19217258IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12220255IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MDEGGGGGEF PPKKDGVEES SFPAKTPARQ LDFTGGSDEH SVSKPAPTVF ATAANTIATP  60
SVPSPAAITT PTTTRPPPPA VGIGQVRPTL PVATPNPPPQ SQILNASIRL PKPESPKSRP  120
RPIVEARDGT PQKKKQCNCK HSRCLKLYCE CFASGTYCDG CNCVNCFNNV ENEPARREAV  180
EATLERNPNA FRPKIASSPH GVRDKREEIG EVVLLGKHNK GCHCKKSGCL KKYCECFQAN  240
ILCSENCKCL DCKNFDGSEE RQALFHGEHA NNMAYLQQQA NAAITGAVGS SGFAPAPAPK  300
RRKGQDIVFN QATKDSSTHR LGQFQQANSG RTSGPTSGTS PSPVSRAGGN VPSKFVYRSL  360
LADIIQPQDV KALCSVLVAV AGEAAKTFTD QRNETESRVK DQTETSLATS AQDQPQGNKD  420
AADVEMVAAD ENQADKSVTE DPSSNGADPS KAKPLSPATL ALMCDEQDTI FMVAAASPNG  480
SVDPGGCGTN SQGQSEVYAE QERVVLTKFR DCLSRLISYA ELKESKCSSL ARRHVQSPAA  540
TTTTTVTVKT ENGIQQIPPV MNGASRTTTQ PTINKPQPLQ LTTATNTSNP HHLHKPPPLS  600
EKKDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A8e-351252662132Protein lin-54 homolog
5fd3_B8e-351252662132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10024708m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186580.0AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059310.0BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412891.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLV4MD100.0V4MD10_EUTSA; Uncharacterized protein
STRINGXP_006412891.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein