PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10024624m
Common NameEUTSA_v10024624mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family CPP
Protein Properties Length: 663aa    MW: 72090.9 Da    PI: 5.7065
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10024624mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.63.8e-16359397240
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Thhalv10024624m 359 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 397
                      689**********************************96 PP

2TCR52.69.3e-17444482139
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  Thhalv10024624m 444 RHKRGCNCKKSNCLKKYCECFQGGVGCSINCRCEGCKNA 482
                      589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19358399IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.6359484IPR005172CRC domain
PfamPF036386.3E-12361396IPR005172CRC domain
SMARTSM011142.1E-17444485IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.9E-12446482IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MDTPQKSITQ IGTPISKSKF EDSPLFNYIN SLSPIRPVKS IPIPHHFSSL NFTSPPSVFT  60
SPHLTSSHKE SRFFKTHNSS SDPTNPVEES TSNEEVAAAE AGDASIGEEA SIEMELPQII  120
KYDRDDPVAA SPCGRETVDL SLVPYSPPRG ENGSSEDASG MELQKMYDEN VQGKNETPDW  180
ESLISDASEL LIFGSPNDSE AFRCLMMQRA STSGVEIPKM QPGSKNEPES SDAIPCEAVS  240
FLHRGIRRRC LDFEMPGNKQ TSSESNTSAC GSSSRCVLPS IGLHLNAILM SSKDSCSGNI  300
QVGLQGSSST LQESLVIQTE NETPEDADQD VPVEPAMEEL HLSSPKKKRL KLEAGEGESC  360
KRCNCKKSKC LKLYCECFAA GVYCIEPCSC IDCFNKPIHE DTVLATRKQI ESRNPLAFAP  420
KVIRSSDSVI ETGDDASKTP ASARHKRGCN CKKSNCLKKY CECFQGGVGC SINCRCEGCK  480
NAFGRKDGSS TVDMEAEQEE ENETSEKSKT AKTQQNTEVL MRKEESSVLP TTPMSMYRQQ  540
LVQLPFSSSK NMMPPPQSLL GGGSSSSGIF NSQYLRKQDI SLIQSRTKKS FETVTEDGVA  600
EMPEILSHSS IDKIKAVSPN GKRVSPPHLD SSSPGSILGR RSGGRKLILN SIPSFPSLTP  660
QH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1636348114120Protein lin-54 homolog
5fd3_B2e-1636348114120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1344351PKKKRLKL
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10024624m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1615391e-105AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39.
GenBankCP0026871e-105CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankZ973371e-105Z97337.2 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006414644.10.0protein tesmin/TSO1-like CXC 2
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLV4MKR90.0V4MKR9_EUTSA; Uncharacterized protein
STRINGXP_006414644.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]