PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10023913m
Common NameEUTSA_v10023913mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 152aa    MW: 17254.2 Da    PI: 9.7711
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10023913mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF28.12.6e-091149341
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                     i++ + r+ +f  R++g++KK   L + C+++++ +i+ 
  Thhalv10023913m 11 ISDGTVRKASFKHRKKGLMKKLDQLKTICNVDACAVIYD 49
                     89999*****************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.189148IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.89E-18181IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-12160IPR002100Transcription factor, MADS-box
CDDcd002661.96E-21285No hitNo description
PfamPF003196.8E-111150IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MGKKKLNLAY ISDGTVRKAS FKHRKKGLMK KLDQLKTICN VDACAVIYDP FNSNPEVWPS  60
NSGVVNVIKK FEMLTEMEKT CRSVNQEGFL SREIAKVKKK SQKLAQENKE GYMRELMFGF  120
LGGNMEGLCM QDNDRHGLCS YIDQYLIITK T*
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10023913m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013630382.12e-59PREDICTED: agamous-like MADS-box protein AGL80
RefseqXP_013669263.16e-59agamous-like MADS-box protein AGL80
TrEMBLV4MEB51e-108V4MEB5_EUTSA; Uncharacterized protein
STRINGXP_006392310.11e-109(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.19e-58AGAMOUS-like 46