PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10023859m
Common NameEUTSA_v10023859mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family GeBP
Protein Properties Length: 100aa    MW: 11348.6 Da    PI: 4.5668
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10023859mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57358.51.9e-185099252
           DUF573  2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsks 52
                     +fqr+w+e+Dei++LqG+id++++++ +p++d+++f+e  kksisf+vsks
  Thhalv10023859m 50 YFQRIWTEDDEIAFLQGVIDYNKDNE-NPYEDTNDFFELGKKSISFEVSKS 99
                     8********************88888.**********************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.3E-125198IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MTKKVKSSAA KYDTKMLSVE IDKSEASAKK VKGGEDEKKS VGEEETKMNY FQRIWTEDDE  60
IAFLQGVIDY NKDNENPYED TNDFFELGKK SISFEVSKS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391891.13e-65hypothetical protein EUTSA_v10023859mg
TrEMBLV4KH553e-65V4KH55_EUTSA; Uncharacterized protein
STRINGBra031402.1-P9e-18(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.14e-20DNA-binding storekeeper protein-related transcriptional regulator