PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10023854m
Common NameEUTSA_v10023854mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 150aa    MW: 17491 Da    PI: 8.7362
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10023854mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.88.2e-125197551
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51
                     k+ rr ++NRe+A+rsR+RKk + e L+e+v  L  +N++Lk++l +
  Thhalv10023854m 51 KKRRRTMSNRESAKRSRLRKKRRFEDLTEEVNRLNLKNQELKNRLAN 97
                     899***************************************88754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.3E-114197No hitNo description
SMARTSM003381.4E-1046118IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.97849112IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.99E-95199No hitNo description
PfamPF001701.6E-95197IPR004827Basic-leucine zipper domain
PROSITE patternPS0003605469IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MFSTNLEPVH ICFEDAMITG DEITEILAFL QSSDLDKSSG SNELVEPVDE KKRRRTMSNR  60
ESAKRSRLRK KRRFEDLTEE VNRLNLKNQE LKNRLANVLR SGNFISRENN RLKTESVCLE  120
IRLVELYRFL VAMQSLTSTR LSYITEFEI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15272RRRTMSNRESAKRSRLRKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006392278.11e-103hypothetical protein EUTSA_v10023854mg
TrEMBLV4KEK91e-103V4KEK9_EUTSA; Uncharacterized protein
STRINGBra027855.1-P8e-71(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122322432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59530.17e-71basic leucine-zipper 4