PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10023533m
Common NameEUTSA_v10023533mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 373aa    MW: 42021.6 Da    PI: 9.6762
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10023533mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.51.2e-072412871763
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      A+rsR RK+++i eLe+ v++L+ae ++   el+ l++    l +e+
  Thhalv10023533m 241 AQRSRVRKLQYISELERNVQALQAEGSKVSAELDFLNQRNLILSMEN 287
                      89********************************9999887777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0081230289IPR004827Basic-leucine zipper domain
CDDcd147031.05E-14233280No hitNo description
Gene3DG3DSA:1.20.5.1704.3E-5241281No hitNo description
SuperFamilySSF579591.06E-5241283No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MANSKGSQSV KDLTYPGKNA LLPPKIPFPS VSAPYSEYIP SGSIGSRHNQ KLSVEKTHHQ  60
RTSSESDLVE EPPFWLDDLL NEPESPVRKC GHRRSSSDSY AYLDMANAKN ISLTLQNDFS  120
YRNVGSSNQR GTQELDWNKN AQDAAFYPDA NFLKQTIRQR ESLVASGPRS SWLPFTRESV  180
GGKHMGPSYM SQEATVKSET KNYAKTLSHE AKKFSPEEKN SSPQPGTYDA DNTRRAKQQF  240
AQRSRVRKLQ YISELERNVQ ALQAEGSKVS AELDFLNQRN LILSMENKAL KHRLESIAQE  300
KLLKQLEQEV LEKEIGRLRA LYQQQQQTNQ PSASHGRSTS KDLDSQFSSL SLNTKDSNCR  360
RDSVSVTGQF HF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529290.0AK352929.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-09-A16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006392343.10.0hypothetical protein EUTSA_v10023533mg
RefseqXP_006392344.10.0hypothetical protein EUTSA_v10023533mg
TrEMBLE4MWN20.0E4MWN2_EUTHA; mRNA, clone: RTFL01-09-A16
TrEMBLV4JW230.0V4JW23_EUTSA; Uncharacterized protein
STRINGAl_scaffold_0002_6820.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33602444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.20.0bZIP family protein