PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10022883m
Common NameEUTSA_v10022883mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 173aa    MW: 18908.8 Da    PI: 4.9402
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10022883mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.11.6e-122986562
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                     ++ +r+ +NRe+ArrsR RK++ ++ L+  + +L++ N++    l   ++++ k ++e
  Thhalv10022883m 29 RKRKRMLSNRESARRSRMRKQKHVDDLTAQINQLSSDNRQILTSLTVTSQLYMKIQAE 86
                     57899*********************************99887777777777666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.3E-162589IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.8E-102670No hitNo description
PROSITE profilePS5021710.222790IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.8E-122980No hitNo description
PfamPF001701.4E-92979IPR004827Basic-leucine zipper domain
CDDcd147028.73E-223081No hitNo description
PROSITE patternPS0003603247IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MASSSSTYRS SSSSDGGNPS DSVVAVDERK RKRMLSNRES ARRSRMRKQK HVDDLTAQIN  60
QLSSDNRQIL TSLTVTSQLY MKIQAENSVL TAQMSELSTR LESLNEIVDL VTTNNGGAGF  120
SGVDQIDGCG FDDRTVGINS DGYYDDMMGS VNHWGGSVYT NQPIMANDIN MY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12849RKRKRMLSNRESARRSRMRKQK
24148RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00267DAPTransfer from AT2G18160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534850.0AK353485.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-45-P17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006409191.11e-124hypothetical protein EUTSA_v10022883mg
TrEMBLE4MY881e-124E4MY88_EUTHA; mRNA, clone: RTFL01-45-P17
TrEMBLV4M3781e-124V4M378_EUTSA; Uncharacterized protein
STRINGBra039631.1-P2e-97(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18160.11e-92basic leucine-zipper 2