PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10022810m
Common NameEUTSA_v10022810mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 266aa    MW: 29006.5 Da    PI: 5.9096
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10022810mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1279.5e-0990136551
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                      k  +r   NReA r++R++Kka+ + Le++v  L a N +L k+l+ 
  Thhalv10022810m  90 KSKKRPLGNREAVRKYREKKKAKAASLEDEVIRLRAVNNQLLKRLQG 136
                      66788899**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.7E-1483154No hitNo description
SMARTSM003381.1E-986153IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.64688135IPR004827Basic-leucine zipper domain
PfamPF077166.9E-1589143IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.01E-791135No hitNo description
CDDcd146866.79E-1194144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MDDGELEFSN QEALSNPKMP EFPPSNCSMD SFFDELLNDS HACTHTHTCN PPGPENTHTH  60
TCLHVHTKIL PAQSDDKAST DDTSESSGKK SKKRPLGNRE AVRKYREKKK AKAASLEDEV  120
IRLRAVNNQL LKRLQGQAAL EAEVTRLKCL LVDIRGRIEG EIGAFPYQKP AVTNVPFSYM  180
MNPCNMQCDV DNLYCLQNGN IGEGASMNEQ GLNGCEFEQL QCLGNQNLAG KEIPLCSNGN  240
GTFSVDASGA NKRKGEITST LGSLS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006409393.10.0hypothetical protein EUTSA_v10022810mg
SwissprotQ8GTS21e-158BZP23_ARATH; Basic leucine zipper 23
TrEMBLV4NVJ90.0V4NVJ9_EUTSA; Uncharacterized protein
STRINGscaffold_303970.11e-160(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-153bZIP family protein