PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10022353m
Common NameEUTSA_v10022353mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 365aa    MW: 39873.6 Da    PI: 8.0975
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10022353mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.18.4e-54171441128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelvv+yLk+k+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl+
  Thhalv10022353m  17 LPPGFRFHPTDEELVVHYLKRKAASAPLPV-AIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLT 109
                      79****************************.88***************999999**************************************99 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + ++++vg+kk Lvfy+g+ pkg+k+dW+mheyrl
  Thhalv10022353m 110 SeGNQKVGVKKALVFYSGKPPKGVKSDWIMHEYRL 144
                      867888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6512178IPR003441NAC domain
PROSITE profilePS5100562.24917178IPR003441NAC domain
PfamPF023656.3E-2818144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MESTDSSGGP PPPQPNLPPG FRFHPTDEEL VVHYLKRKAA SAPLPVAIIA EVDLYKFDPW  60
ELPAKASFGE QEWYFFSPRD RKYPNGARPN RAATSGYWKA TGTDKPVLTS EGNQKVGVKK  120
ALVFYSGKPP KGVKSDWIMH EYRLIDNKPN NRPPGCDFGN KKNSLRLDDW VLCRIYKKNN  180
AGRHVDNDKD HDMIDYIFRK IPPSISMAAA TTGLHHNVSR SMNFFPGKFS SGGYGIFSDG  240
DPGLYDAGMI NSIGTDHNHG SGSNGNTNAV GLNPASSSEP MMMANLKRAL PASYWPVPEE  300
EQDVSPSKRF HGGGGGGGGD CSNMSSSMME ETHPPLMQQQ GGVLGDGLFR TTSYQLPGLN  360
WYSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-741118311170NO APICAL MERISTEM PROTEIN
1ut4_B1e-741118311170NO APICAL MERISTEM PROTEIN
1ut7_A1e-741118311170NO APICAL MERISTEM PROTEIN
1ut7_B1e-741118311170NO APICAL MERISTEM PROTEIN
3swm_A1e-741118314173NAC domain-containing protein 19
3swm_B1e-741118314173NAC domain-containing protein 19
3swm_C1e-741118314173NAC domain-containing protein 19
3swm_D1e-741118314173NAC domain-containing protein 19
3swp_A1e-741118314173NAC domain-containing protein 19
3swp_B1e-741118314173NAC domain-containing protein 19
3swp_C1e-741118314173NAC domain-containing protein 19
3swp_D1e-741118314173NAC domain-containing protein 19
4dul_A1e-741118311170NAC domain-containing protein 19
4dul_B1e-741118311170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3532260.0AK353226.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-33-D23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406961.10.0hypothetical protein EUTSA_v10022353mg
SwissprotQ9LD440.0NAC56_ARATH; NAC transcription factor 56
TrEMBLE4MXH90.0E4MXH9_EUTHA; mRNA, clone: RTFL01-33-D23
TrEMBLV4LX280.0V4LX28_EUTSA; Uncharacterized protein
STRINGAT3G15510.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.10.0NAC domain containing protein 2