PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10021674m
Common NameEUTSA_v10021674mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family LBD
Protein Properties Length: 164aa    MW: 17935.6 Da    PI: 6.6603
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10021674mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.21.5e-39111101100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+l+r+C++ C++apyf +++p +fa vhk+FGasnv+kll+++p+e+r+++++sl+yeAe+r++dPvyG++g i +lq+++ +l+++l
  Thhalv10021674m  11 SCAACKLLKRRCTPTCIFAPYFRSSDPITFAKVHKVFGASNVSKLLSEVPDEQRQETVNSLAYEAEVRLKDPVYGCIGAIASLQKKMLELQHDL 104
                      6********************************************************************************************* PP

           DUF260  95 allkee 100
                      a+++++
  Thhalv10021674m 105 AVARTR 110
                      999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.73610111IPR004883Lateral organ boundaries, LOB
PfamPF031956.5E-3911108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MRGHEPRSSS SCAACKLLKR RCTPTCIFAP YFRSSDPITF AKVHKVFGAS NVSKLLSEVP  60
DEQRQETVNS LAYEAEVRLK DPVYGCIGAI ASLQKKMLEL QHDLAVARTR LLAHSGANNH  120
VPPLDDSPEL AAFLDLVPYS DLMLLDGSSL DAYLYDLGQP PFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-4361156115LOB family transfactor Ramosa2.1
5ly0_B4e-4361156115LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10021674m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2546080.0AC254608.1 Capsella rubella clone CAP16-D12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407473.11e-117LOB domain-containing protein 21
SwissprotQ9SRL81e-109LBD21_ARATH; LOB domain-containing protein 21
TrEMBLV4NQN61e-116V4NQN6_EUTSA; Uncharacterized protein
STRINGXP_006407473.11e-117(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM102552735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.11e-102LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]