PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10021250m
Common NameEUTSA_v10021250mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NF-YA
Protein Properties Length: 292aa    MW: 32342.1 Da    PI: 10.5154
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10021250mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.83.1e-32153209158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep++VNaKQyq+Il+RRq+Rakle+++kl +k rkpylheSRh hAl+R+RgsgGrF
  Thhalv10021250m 153 NEPIFVNAKQYQAILRRRQHRAKLEAQNKL-IKVRKPYLHESRHLHALKRARGSGGRF 209
                      59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.9E-36151212IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.507152212IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-26154209IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.4E-22155177IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860157177IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.4E-22186209IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MTDKSNNTLS MKMEMMSTHF PGMQQTGFQL QEHDSSSTQS TRGDSSGEVA SLGEHNNNKR  60
YGHSSVTHLS DAGYKENAGN PSGSHSKSIL SKVSQNSAVP STIEASWPLH GTETPHYNGF  120
MSFPYASQHT VQHPQIGGLV PCRMLLPHNT QENEPIFVNA KQYQAILRRR QHRAKLEAQN  180
KLIKVRKPYL HESRHLHALK RARGSGGRFL NTKKLQESKS PQSPSFLGTP RFFKNPQGKF  240
RQREIPGVGV GSSGSATSCS DLTGNNNDMF QQNPQFRFSG YPSNHHVSVL M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-19153231278NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10021250m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024015183.10.0nuclear transcription factor Y subunit A-6 isoform X1
SwissprotQ9LVJ71e-133NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLV4NPX00.0V4NPX0_EUTSA; Uncharacterized protein
STRINGXP_006407138.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147331620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.11e-126nuclear factor Y, subunit A6
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]