PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10021174m
Common NameEUTSA_v10021174mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 314aa    MW: 35610.9 Da    PI: 8.8551
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10021174mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.86.4e-51141391128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrF Ptdeel+veyL++k+ g++++l + i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + +
  Thhalv10021174m  14 LPPGFRFYPTDEELMVEYLCRKAVGHDFSL-QLIAEIDLYKFDPWVLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVIST 106
                      79***************************9.89***************8777899**********************************99999 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  Thhalv10021174m 107 -EGRRVGIKKALVFYVGKAPKGTKTNWIMHEYRL 139
                      .9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-6610162IPR003441NAC domain
PROSITE profilePS5100559.65714162IPR003441NAC domain
PfamPF023652.2E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGIQELDPLA QLSLPPGFRF YPTDEELMVE YLCRKAVGHD FSLQLIAEID LYKFDPWVLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVISTEGRR VGIKKALVFY  120
VGKAPKGTKT NWIMHEYRLF EPSRRNGSTK LDDWVLCRIY KKQSSAQKQI YSNLMTREYS  180
NNGSSTSSSS HQYDDVLESL HEIDNRSMRF AASSSNAIPH SHRPVLTEQK TGFHSLVREP  240
SFDWTNFGGQ NSVSELGGGY FHGVKTIQED GRTQQHGEGI TLFNNPDVLP HQNVDPVNRY  300
GYSGQQPNGF GFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-11811687174NAC domain-containing protein 19
3swp_C1e-11811687174NAC domain-containing protein 19
3swp_B1e-11811687174NAC domain-containing protein 19
3swp_A1e-11811687174NAC domain-containing protein 19
3swm_D1e-11811687174NAC domain-containing protein 19
3swm_C1e-11811687174NAC domain-containing protein 19
3swm_B1e-11811687174NAC domain-containing protein 19
3swm_A1e-11811687174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00360DAPTransfer from AT3G15500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0256590.0BT025659.1 Arabidopsis thaliana At3g15500 mRNA, complete cds.
GenBankAB0490700.0AB049070.1 Arabidopsis thaliana AtNAC3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406962.10.0hypothetical protein EUTSA_v10021174mg
SwissprotQ9LDY80.0NAC55_ARATH; NAC domain-containing protein 55
TrEMBLV4LD820.0V4LD82_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.3__1697__AT3G15500.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.10.0NAC domain containing protein 3