PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10021011m
Common NameEUTSA_v10021011mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 358aa    MW: 40901.9 Da    PI: 8.1922
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10021011mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.84.2e-53101401128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+ +yL+kkv++++++l +vi++vdiyk++PwdLp+k+  +ekewyfFs+rd+ky++g r+nra++sgyWkatg+dk +++
  Thhalv10021011m  10 LPPGFRFHPTDEELILHYLRKKVSSSPVPL-SVIADVDIYKFDPWDLPAKAPFGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKLIVV 102
                      79****************************.99***************988899**************************************** PP

              NAM  95 k....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                            +e++g+kk Lvfy+g+ pkg+kt+W+mheyrl
  Thhalv10021011m 103 PngegFNENIGIKKALVFYRGKPPKGVKTNWIMHEYRL 140
                      955554456***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-627186IPR003441NAC domain
PROSITE profilePS5100560.46710186IPR003441NAC domain
PfamPF023657.2E-2811140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MISKNPRSSL PPGFRFHPTD EELILHYLRK KVSSSPVPLS VIADVDIYKF DPWDLPAKAP  60
FGEKEWYFFS PRDRKYPNGA RPNRAAASGY WKATGTDKLI VVPNGEGFNE NIGIKKALVF  120
YRGKPPKGVK TNWIMHEYRL AESLSPKRLC HSRTGIQVNN SGDRNLKSKE YSMRLDDWVL  180
CRIYKKSHAS LSSPDVASAT SDQENEENDN EPFLVSETLL PNLANDQTLK RQKSSFSNLL  240
DATDLTFLTN FLNETPENRT ESEFSFMFEN FSKPDIYGNR YLDQKLPQLS SPTSETSVIG  300
NKRERLDFAE ETMNTSKRMI NNFSYNNSIG HLDHSMVQQS SFLNQEFLMS PHLQYQG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-70919016169NAC domain-containing protein 19
4dul_A2e-70919016169NAC domain-containing protein 19
1ut7_B2e-70919016169NO APICAL MERISTEM PROTEIN
1ut7_A2e-70919016169NO APICAL MERISTEM PROTEIN
1ut4_B2e-70919016169NO APICAL MERISTEM PROTEIN
1ut4_A2e-70919016169NO APICAL MERISTEM PROTEIN
3swp_D2e-70919019172NAC domain-containing protein 19
3swp_C2e-70919019172NAC domain-containing protein 19
3swp_B2e-70919019172NAC domain-containing protein 19
3swp_A2e-70919019172NAC domain-containing protein 19
3swm_D2e-70919019172NAC domain-containing protein 19
3swm_C2e-70919019172NAC domain-containing protein 19
3swm_B2e-70919019172NAC domain-containing protein 19
3swm_A2e-70919019172NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747600.0KF974760.1 Brassica napus NAC transcription factor 47-1 (NAC47-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006408226.10.0hypothetical protein EUTSA_v10021011mg
SwissprotA2YMR03e-83NAC10_ORYSI; NAC transcription factor ONAC010
TrEMBLV4M0Q70.0V4M0Q7_EUTSA; Uncharacterized protein
STRINGBra040152.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77232540
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.10.0NAC domain containing protein 47