PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10020772m
Common NameEUTSA_v10020772mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 433aa    MW: 46758.3 Da    PI: 10.387
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10020772mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.51.3e-12354407558
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                      +r+rr++kNRe+A rsR+RK+a++ eLe ++++L++ N++L+ +  e+ ++ ++
  Thhalv10020772m 354 RRQRRMIKNRESAARSRARKQAYTLELEAEIEKLKKVNQELQRKQAEMMEMQKN 407
                      69***************************************8666555555443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.8E-10350415IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.53352403IPR004827Basic-leucine zipper domain
CDDcd147074.32E-24354406No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-12354410No hitNo description
SuperFamilySSF579591.25E-9354403No hitNo description
PfamPF001702.6E-10354407IPR004827Basic-leucine zipper domain
PROSITE patternPS000360357372IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MGTHINFNNL GGGGPQGGEG SNQMKPTGSA IPLARQSSVY SLTFDELQNT LGGPGKDFGS  60
MNMDELLKSI WTAEEAQAMA MTSPAVTAVA QPGGNLQRQG SLTLPRTISQ KTVDEVWKCL  120
ITKDSRNGNM GGSSGGGGES NAPPVRQQTL GEMTLEEFLF RAGVVREDNC TQQMGQVNGN  180
NNNGFYGNNG AAGGLGFGFG QPNQNSISFN GNNDSMILNQ PPGLGLKVGG AMQQQPQQQF  240
QQQPQLQLQQ QPRQQLNQPH PQQQQQRLPQ TIFPKQANVA FAGPVGMVNK NYAGAANNSI  300
NNNNGLASFG GAGVTVAATS PGTSSAENNS LSPVPYVLNR GRRSNTGLEK VIERRQRRMI  360
KNRESAARSR ARKQAYTLEL EAEIEKLKKV NQELQRKQAE MMEMQKNELK ESSKQPWGSK  420
RQCLRRTLTG PW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9719740.0JQ971974.1 Eutrema salsugineum abscisic acid responsive elements-binding factor 4 (ABF4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406516.10.0hypothetical protein EUTSA_v10020772mg
SwissprotQ9M7Q20.0AI5L7_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLV4LVU40.0V4LVU4_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.3__2145__AT3G19290.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.11e-178ABRE binding factor 4