PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10020745m
Common NameEUTSA_v10020745mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 441aa    MW: 49739.7 Da    PI: 5.6672
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10020745mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.74.5e-53271541128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      l+pGfrFhPtdeelv++yLk+kv++k++++ ++i evdiyk+ePwdL   +++k++++ewyfFs  dkky +g r nrat++gyWkatgkd+e+
  Thhalv10020745m  27 LAPGFRFHPTDEELVSYYLKRKVQNKPVRF-DAIGEVDIYKHEPWDLAvfSRLKTRDQEWYFFSALDKKYGNGARMNRATNKGYWKATGKDREI 119
                      579************************999.99**************8544899999************************************* PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + + +l g+kktLvf++grap+g +t+Wvmheyrl
  Thhalv10020745m 120 RR-DIQLLGMKKTLVFHSGRAPDGLRTNWVMHEYRL 154
                      *9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-6019179IPR003441NAC domain
PROSITE profilePS5100557.53227178IPR003441NAC domain
PfamPF023658.3E-2829154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MGRESVAALS SPPTATATGT AAAATSLAPG FRFHPTDEEL VSYYLKRKVQ NKPVRFDAIG  60
EVDIYKHEPW DLAVFSRLKT RDQEWYFFSA LDKKYGNGAR MNRATNKGYW KATGKDREIR  120
RDIQLLGMKK TLVFHSGRAP DGLRTNWVMH EYRLVEYETE KNGNLVQDAY VLCRVFHKNN  180
IGPPSGNRYA PFMEEEWADD EGALIPGVDV RARVEPLRLA NGNNHMDEET QPGTKDLINI  240
NEPPNETTPM DHQNHDENNQ CNEGEEAPKR EHADEEDRPP PLCVLNKEAP LPLLQYKRRR  300
QNESNNNSSM TTLEHCSSTT TTVDNTPTLV SSSAAAATNT AISALLEFSL MGISDKKENP  360
QQPLLRPHKE ASPPTPLASP EEKLNDLQKE IHQMSVERET FKLEMMSAEA MISILQSRID  420
ALRQENDELR KNNAKGQEML *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-482618019170NAC domain-containing protein 19
3swp_C3e-482618019170NAC domain-containing protein 19
3swp_B3e-482618019170NAC domain-containing protein 19
3swp_A3e-482618019170NAC domain-containing protein 19
3swm_D3e-482618019170NAC domain-containing protein 19
3swm_C3e-482618019170NAC domain-containing protein 19
3swm_B3e-482618019170NAC domain-containing protein 19
3swm_A3e-482618019170NAC domain-containing protein 19
4dul_B4e-482618016167NAC domain-containing protein 19
4dul_A4e-482618016167NAC domain-containing protein 19
1ut7_B4e-482618016167NO APICAL MERISTEM PROTEIN
1ut7_A4e-482618016167NO APICAL MERISTEM PROTEIN
1ut4_B4e-482618016167NO APICAL MERISTEM PROTEIN
1ut4_A4e-482618016167NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0597640.0AY059764.1 Arabidopsis thaliana At3g10490 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407563.10.0hypothetical protein EUTSA_v10020745mg
TrEMBLV4NQY60.0V4NQY6_EUTSA; Uncharacterized protein
STRINGAT3G10490.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.20.0NAC domain containing protein 52