PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10020373m
Common NameEUTSA_v10020373mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family CPP
Protein Properties Length: 582aa    MW: 63902.9 Da    PI: 8.1636
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10020373mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.83.4e-16300338240
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Thhalv10020373m 300 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 338
                      689**********************************96 PP

2TCR52.41.1e-16385423139
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  Thhalv10020373m 385 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNA 423
                      589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-19299340IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.529300425IPR005172CRC domain
PfamPF036385.4E-12302337IPR005172CRC domain
SMARTSM011144.2E-17385426IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.3E-12387423IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MDTPPKTVTQ IGTPISKLKV ENSPVFNFIN SLSPIKPVKS IPIAQTFGSL SFSSPPSVFT  60
SPHAASHKGS RFKSHNNSSK DESASNAELA SIGEEVEVEE ASIEIEPSTQ IIKNDCITAT  120
TPKVVNDGSC KDGEMDLQKM CDHNVKPKSK TPDWGSLFSD SELLIYGSPN DSEAYRCFLQ  180
RQSNSETRLS GGKKLTLEPV SNSNEPESSD ALHRGVRRRC LDFEIPGKNK QTSGESSSRC  240
VVRNIGLHLN AIAMSSKDSN VANEYSFSGN IKSSALVELN QSSPKKKRRK SEQAGDGESS  300
CKRCNCKKSK CLKLYCECFA AGVYCIEPCS CIDCFNKPIH EDTVLATRKQ IESRNPLAFA  360
PKVIRNSDSI MEVGDDATKT PASARHKRGC NCKKSNCLKK YCECYQSGVG CSINCRCEGC  420
KNAFGRKDGS SFVAMDIEHD DETAKPQHHA ELFNSVPIPP STPMPLRQPL AQLPISSNNV  480
LLTQQSQHFH GASLYKYQSF WKQDMSLLSH SRIETITEER AEDTENLIQS PITTNINAVS  540
PNSKRVSVSH LDSSESSPWR RNSGRKLLLS IPTFPSLTPH H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-1730242212120Protein lin-54 homolog
5fd3_B4e-1730242212120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1284288KKKRR
2284289KKKRRK
3285289KKRRK
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00044PBMTransfer from AT3G22760Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10020373m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2051421e-173AF205142.1 Arabidopsis thaliana CXC domain containing TSO1-like protein 1 (SOL1) mRNA, complete cds.
GenBankAY0996531e-173AY099653.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
GenBankAY1288371e-173AY128837.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024015205.10.0protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLV4M5N20.0V4M5N2_EUTSA; Uncharacterized protein
STRINGXP_006406130.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]