PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10020207m
Common NameEUTSA_v10020207mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 678aa    MW: 73699.9 Da    PI: 6.6083
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10020207mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.62.8e-13195256162
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      e ++k+  ++++NRe+A+ sR+RKk+++eeL+ +vk++ +   +L  +++    e a+l+++
  Thhalv10020207m 195 EDDDKKKTKMIRNRESAQLSRLRKKQYLEELQGRVKSMNSTIAELNGKISFVMAENAALRQQ 256
                      5789************************************9999999999988888888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.5E-14193259No hitNo description
SMARTSM003381.6E-16195259IPR004827Basic-leucine zipper domain
PfamPF001702.4E-10197256IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.783197260IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.44E-11199257No hitNo description
CDDcd147045.41E-16200251No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006990Biological Processpositive regulation of transcription from RNA polymerase II promoter involved in unfolded protein response
GO:0009408Biological Processresponse to heat
GO:0005635Cellular Componentnuclear envelope
GO:0005654Cellular Componentnucleoplasm
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0048471Cellular Componentperinuclear region of cytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MTESTSVIAH PPEMPDLNPN MQSNPDMIPI PPLDPLFLSA SDPISMEHPI SDLDFLLDDE  60
NGDFADFDFP FDDSDDFFNF TFDAAEELGS SGDQSPEAIG NHASLDSSEN RNGDRGSEGR  120
SDSVHSQVSS QGSKTFVSGA CDTVDVLSSP DSSNLGIHQK SSVSKRKKEK GDSGGEYRSS  180
KYQKSDGKST AAIEEDDDKK KTKMIRNRES AQLSRLRKKQ YLEELQGRVK SMNSTIAELN  240
GKISFVMAEN AALRQQMAAA SGAPPMNPYM AAPPLPYQWM PYPPYPVRAY GSQTPLVPIP  300
KLNPKPVSGC RPKKAESKKI EGKSKLKKVA SISFIGILFF IFLFGTLVPF MNVNNGGDSG  360
SFGGLTNYEG RRYYEEHKGK VLMVGDGSEG NIHSSRRSHG ERESCGGVDY SAHPKVEGRP  420
SSLCNASEPL FASLYVPRND GLVKIDGNLI IHSVLASEKA TAFAKMNNSE TIKSKEHELT  480
IPGVLSSALA VPEVRGNGAM LPHSKALSSG SAEGKRLHQW FHEGGSGTLM DYSMCTEVFQ  540
FDIAPGAIVP SSVSNITREH LQNVTTHDKR MKNRRILEGL PVSLVASELN ITEAQPTKDA  600
QNKSFHGNTN NKPKSSSSMV VSVLLDPREI VDSETDRVMP SNPKSLSRIF VVVLLDSVKY  660
VTYSCVLPRS GLHLVAT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00345DAPTransfer from AT3G10800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531170.0AK353117.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-21-B04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407504.10.0hypothetical protein EUTSA_v10020207mg
SwissprotQ9SG860.0BZP28_ARATH; bZIP transcription factor 28
TrEMBLE4MX700.0E4MX70_EUTHA; mRNA, clone: RTFL01-21-B04
TrEMBLV4M2980.0V4M298_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.3__1116__AT3G10800.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM143971822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10800.10.0bZIP family protein