PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10020174m
Common NameEUTSA_v10020174mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family CPP
Protein Properties Length: 701aa    MW: 77347.7 Da    PI: 5.8663
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10020174mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.54e-16403441240
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Thhalv10020174m 403 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 441
                      689**********************************96 PP

2TCR512.8e-16488526139
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Thhalv10020174m 488 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNA 526
                      589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19402443IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.614403528IPR005172CRC domain
PfamPF036386.8E-12405440IPR005172CRC domain
SMARTSM011143.7E-17488529IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11490526IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MDNPQKKSSS QMETPTPKSK FEDSPVFNYI NNLSPIEPVK SISTAQTFSS LSFTSPPPVF  60
TSPHASFHRE SRFFRCHYSA DRSKALDSKE EVVASADVDL NKDATLEEEE NEEEKASIEA  120
SCELPQVLKS DSQTPDRGDS PCAGDVVEEV LVDPSDTPRG DNASSSEDVK MSLQKVVDAR  180
EEDNTPGCGR LMADASELLV FRSPNDSEAF RCLVDKISSS ERRFCAGVKS TKEQDISKDI  240
PVNGSSDDNE PLAVLPNESV SHLHRGSMRR RCLDFEVPGK RKKDIADDQQ TVCENKAESS  300
SKCVVPGIGL HLNAIAMSLR DRKINVMHEY STSEEIQMSL TGSTTPIHSQ DTVLETLDQA  360
ESEPGEGQAL EEAPNALVLF EQLNPSSLKK KRRMSEQAGE GESCKRCNCK KSKCLKLYCE  420
CFAAGVYCIE PCSCIDCFNK PIHEDTVLAT RKQIESRNPL AFAPKVIRNS DSIMDASDDA  480
SKTPASARHK RGCNCKKSNC LKKYCECYQG GVGCSINCRC EGCKNAFGRK EDSLLAIMES  540
KQEEDRQTYE KRTAKIQHNS DLSKEVEEQN PRSDQPSTPL PTYRHLVVHQ PFLSKNRLPP  600
TQFFLGAGSS SLRKPDNDLT QPRNEKKPLE TVIEDKTETM PEILTSSPIT TIKAISPNSK  660
RVSPPQIGSS ESGSILGKRS NGRKLILRSI PAFPSLNPNQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-1740752514120Protein lin-54 homolog
5fd3_B4e-1740752514120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1268282RRRCLDFEVPGKRKK
2388392KKKRR
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00370DAPTransfer from AT3G22780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10020174m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406129.10.0CRC domain-containing protein TSO1
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLV4LYI40.0V4LYI4_EUTSA; Uncharacterized protein
STRINGXP_006406129.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]