PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10019731m
Common NameEUTSA_v10019731mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 293aa    MW: 33065.2 Da    PI: 9.5418
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10019731mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF551e-171049241
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                     +ien+s r+ tf kR++gilKK +E+S+LC++ v+ ii+s
  Thhalv10019731m 10 FIENNSSRKATFQKRKKGILKKVKEISTLCGVTVCAIIYS 49
                     8**************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-21160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.46149IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.45E-21289IPR002100Transcription factor, MADS-box
CDDcd002664.15E-26283No hitNo description
PRINTSPR004045.9E-9323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-161049IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-92338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MTRKKVKLAF IENNSSRKAT FQKRKKGILK KVKEISTLCG VTVCAIIYSL YTSNPDVWPS  60
TSGVRRVVSD FQTITKLSKN LRRLEKDNRE QEMIEVMFQC WDGSLERFHL NILDLNDLGY  120
VIGQYQKDIN RKIEILESSS MEMGESSNTA VTAAMVHSFE GIGSLAVASA TTATAAPAAT  180
IHEVYSSSSS AAAATFFNSI QQQQHHHQHQ QFRHPATPHV GFYEQTRNMN LNQIHKHMDN  240
RHNPNLHNPF HHYQHQQQQQ IPSDSSTALT TVSSSSIIHV TSPNPTNNMW FQ*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10019731m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391455.11e-153agamous-like MADS-box protein AGL80
SwissprotQ9FJK31e-77AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLV4KFR60.0V4KFR6_EUTSA; Uncharacterized protein
STRINGXP_006391381.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.15e-60AGAMOUS-like 80
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]