PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10019631m
Common NameEUTSA_v10019631mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 401aa    MW: 45792.4 Da    PI: 7.0632
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10019631mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.12.9e-52151421128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      l pGfrFhPtdeelv++yLk+kve+++l++ + i+++diyk++PwdLpk + a+ekewyf+++rd+ky++++r+nr+t +g+Wkatg+dk+++s
  Thhalv10019631m  15 LLPGFRFHPTDEELVSFYLKRKVEHRPLSI-KLITQLDIYKYDPWDLPKFAMAGEKEWYFYCPRDRKYRNSTRPNRVTGAGFWKATGTDKPIYS 107
                      579***************************.89***************7777889*************************************** PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +++ vgl+k+Lvfykgra kg ktdW+mhe+rl
  Thhalv10019631m 108 SdGSKCVGLRKSLVFYKGRAAKGIKTDWMMHEFRL 142
                      966677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-5810169IPR003441NAC domain
PROSITE profilePS5100557.29815169IPR003441NAC domain
PfamPF023652.1E-2517142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MVENNEEAKK MEDVLLPGFR FHPTDEELVS FYLKRKVEHR PLSIKLITQL DIYKYDPWDL  60
PKFAMAGEKE WYFYCPRDRK YRNSTRPNRV TGAGFWKATG TDKPIYSSDG SKCVGLRKSL  120
VFYKGRAAKG IKTDWMMHEF RLPSASSHTL FDTQVSPNDS WAICRILKKT NTTTLRAISH  180
SFVSSLPQEA RTNTAPYKKP INTAQISSEK ILKNSSCFKY YYEDMNIAQP HSYFDDKETT  240
TNTHFTDSSN NPGPCLDQQY LKSLLIASQE TQPPQFPKFI NNDMISSFLL NMSSSSESSI  300
LGEYANHVDS NIDIDAILAQ EKCPALVSLP QEYHETSFEG NKSGANQDHH RALFHTFRYG  360
DLTSTSTIIG DQHQNQKHHM LMESYYSSID EDLPISLSTT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-551517317169NO APICAL MERISTEM PROTEIN
1ut4_B5e-551517317169NO APICAL MERISTEM PROTEIN
1ut7_A5e-551517317169NO APICAL MERISTEM PROTEIN
1ut7_B5e-551517317169NO APICAL MERISTEM PROTEIN
3swm_A5e-551517320172NAC domain-containing protein 19
3swm_B5e-551517320172NAC domain-containing protein 19
3swm_C5e-551517320172NAC domain-containing protein 19
3swm_D5e-551517320172NAC domain-containing protein 19
3swp_A5e-551517320172NAC domain-containing protein 19
3swp_B5e-551517320172NAC domain-containing protein 19
3swp_C5e-551517320172NAC domain-containing protein 19
3swp_D5e-551517320172NAC domain-containing protein 19
4dul_A5e-551517317169NAC domain-containing protein 19
4dul_B5e-551517317169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893534e-95AC189353.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB043L15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390990.10.0hypothetical protein EUTSA_v10019631mg
SwissprotQ9ZVH01e-170FEZ_ARATH; Protein FEZ
TrEMBLV4MAQ70.0V4MAQ7_EUTSA; Uncharacterized protein
STRINGBra004403.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-162NAC family protein