PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10019568m
Common NameEUTSA_v10019568mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 134aa    MW: 15628.8 Da    PI: 9.7037
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10019568mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.6e-134294355
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
                     + +++rrk++NRe+ArrsR RK+  ++eL     +L +eN+ L +el++ ++ 
  Thhalv10019568m 42 DERKQRRKISNRESARRSRMRKRRHLDELWSMLVQLVNENHCLVDELNRAREG 94
                     6689*******************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.7E-113494No hitNo description
SMARTSM003386.3E-1640104IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.55342105IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.06E-114494No hitNo description
PfamPF001709.2E-114495IPR004827Basic-leucine zipper domain
CDDcd147026.29E-84593No hitNo description
PROSITE patternPS0003604762IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MASIVYNLPC EDSIPEFFGN RVPLLVNLPA TSDEPSRSAE DDERKQRRKI SNRESARRSR  60
MRKRRHLDEL WSMLVQLVNE NHCLVDELNR AREGYKMVVE ENTKLRQENS NSMKMIGEMG  120
LNRFNVKTKS FLT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14664RRKISNRESARRSRMRKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391082.12e-94hypothetical protein EUTSA_v10019568mg
SwissprotQ9CA461e-55BZIP8_ARATH; Basic leucine zipper 8
TrEMBLV4KM432e-94V4KM43_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.2__1145__AT1G68880.12e-56(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150351619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68880.13e-45basic leucine-zipper 8