PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10018888m
Common NameEUTSA_v10018888mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family BES1
Protein Properties Length: 320aa    MW: 34348.1 Da    PI: 8.2032
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10018888mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822213.74.6e-6621441149
           DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspessl 94 
                      ++++r+ptw+ErEnnkrRERrRRaiaaki++GLR+ Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrkgs+p e++e++g sa+asp+ss+
  Thhalv10018888m   2 TSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMFGNYELPKHCDNNEVLKALCNEAGWIVEPDGTTYRKGSRPVERMEIGGGSATASPCSSY 95 
                      5899****************************************************************************************** PP

           DUF822  95 qsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsss 149
                      q        +sp++sy++sp ss+f+sp+s+++ +l+s   +sl+p+l++ls++sss
  Thhalv10018888m  96 Q--------PSPCASYNPSPGSSNFMSPASSSFPNLTSGdgQSLIPWLKHLSTTSSS 144
                      *........*********************99999988788**********997776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.7E-633139IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MTSGTRMPTW RERENNKRRE RRRRAIAAKI FTGLRMFGNY ELPKHCDNNE VLKALCNEAG  60
WIVEPDGTTY RKGSRPVERM EIGGGSATAS PCSSYQPSPC ASYNPSPGSS NFMSPASSSF  120
PNLTSGDGQS LIPWLKHLST TSSSSASSSS RLPNYLYIPG GSISAPVTPP LSSPTARTPR  180
MNPDWQQLNN SFFASSTPPS PTRQIIPDSE WFSGIQLAQS VPASPTFSLV SQNPFGFKEE  240
VASARGGGSR MWTPSQSGTC SPAIPQTADV PMSEAVAPPE FAFGSSNTNG LVKAWEGERI  300
HEESGSDDLE LTLGNSSTR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0903310.0AY090331.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
GenBankAY0504300.0AY050430.1 Arabidopsis thaliana At1g78700/F9K20_26 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006389963.10.0hypothetical protein EUTSA_v10018888mg
SwissprotQ9ZV880.0BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLV4K8A20.0V4K8A2_EUTSA; Uncharacterized protein
STRINGAT1G78700.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-169BES1/BZR1 homolog 4