PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10018715m
Common NameEUTSA_v10018715mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 380aa    MW: 43196.6 Da    PI: 6.6564
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10018715mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1346.5e-1190133447
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                      +k  rr+++NReAAr+sR+RKka++++Lee   +L++  ++L k
  Thhalv10018715m  90 DKMKRRLAQNREAARKSRLRKKAYVQQLEESRLKLSQLEQELEK 133
                      6899**************************98888888776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-482145IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.3E-889134No hitNo description
PROSITE profilePS502179.40489133IPR004827Basic-leucine zipper domain
PfamPF001701.1E-790133IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.01E-691132No hitNo description
PROSITE patternPS00036094109IPR004827Basic-leucine zipper domain
PfamPF141447.7E-30180254IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MMSSPTQLAS LRDMGIYEPF QQLVSWGNVF KSDISDHSPN TASSSIIQVD ARIDDHEHNN  60
IKGNYVTSHN QIEAEPSSND HQDDDGRIHD KMKRRLAQNR EAARKSRLRK KAYVQQLEES  120
RLKLSQLEQE LEKAKQQGLC RRNSSESSYL GTSGRSMINT GIAAFEMEYS HWLEEQSRRV  180
SEIRTALQAH ISDIELKMLV ESCLNHYANL FRMKSDAAKA DVFYLISGMW RTSTERFFQW  240
IGGFRPSELL NVVMPYLQPL TDQQILEVRN LQQSSQQAED ALSQGIDKLQ QSLAESIVID  300
AVIESTDYPP PHMAAAIENL QALEGFVNQA DHLRQQTLQQ MAKILTTRQA ARGLLALGEY  360
LHRLRALSSL WSARPREPT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00247DAPTransfer from AT1G77920Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533840.0AK353384.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-35-N08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390041.10.0hypothetical protein EUTSA_v10018715mg
SwissprotQ93ZE20.0TGA7_ARATH; Transcription factor TGA7
TrEMBLE4MXY70.0E4MXY7_EUTHA; mRNA, clone: RTFL01-35-N08
TrEMBLV4KC580.0V4KC58_EUTSA; Uncharacterized protein
STRINGAl_scaffold_0002_24970.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30612766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.10.0bZIP family protein