PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10017733m
Common NameEUTSA_v10017733mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 278aa    MW: 31761.3 Da    PI: 4.5502
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10017733mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM68.91.4e-21101383128
              NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknra......tksgyWkatg 87 
                      +GfrF+Ptd  lv  +L++ v + k     +i+++d+yk ePw L++ v++    e++wy+F++r +    gk+++r+       + g+W++  
  Thhalv10017733m  10 VGFRFRPTDLGLVRLHLRNMVVHGKSG---CITTLDVYKDEPWLLDH-VNNdlfYENQWYYFVPRPNLG--GKKPKRTvpgrgeSEGGTWRSVT 97 
                      6********************999955...5**************84.333345678*******98753..4455554344444889******* PP

              NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++ke+ + ++++ g  + +v+ k+ +  ++ t+W+m ey+l
  Thhalv10017733m  98 SKKEIDDDNKKVEGYMQGFVYTKQVNGIPVGTNWLMTEYSL 138
                      *******9**************99999999*********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-288153IPR003441NAC domain
PROSITE profilePS5100528.8158154IPR003441NAC domain
PfamPF023655.1E-1410138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MEETQNDRGV GFRFRPTDLG LVRLHLRNMV VHGKSGCITT LDVYKDEPWL LDHVNNDLFY  60
ENQWYYFVPR PNLGGKKPKR TVPGRGESEG GTWRSVTSKK EIDDDNKKVE GYMQGFVYTK  120
QVNGIPVGTN WLMTEYSLHN DVHDDLVLCW IRYNTDKKLK PEVGDQAPRL RNNVQVREDE  180
EADLTGFANV LEDMLVEGEE HGDITQQQQH QDPRIFPPLL QGHDSGSETP MMMTTQSDDN  240
NNMTMPYNEQ NQWGDFGFDG SENLMLDVDG LIGFSGK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411326.10.0hypothetical protein EUTSA_v10017733mg
TrEMBLV4M8V60.0V4M8V6_EUTSA; Uncharacterized protein
STRINGBra004575.1-P1e-54(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14026919
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03490.14e-38NAC domain containing protein 6