PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10016938m
Common NameEUTSA_v10016938mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family Dof
Protein Properties Length: 325aa    MW: 34822.5 Da    PI: 10.1631
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10016938mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.91.1e-3876133461
           zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        lkcprCds+ntkfCy+nny+l+qPr+fCkaCrryWt+GGalrnvPvGgg+r+nkk 
  Thhalv10016938m  76 GVLKCPRCDSANTKFCYFNNYNLTQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKKG 133
                      5789***************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3659129IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3277132IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.68378132IPR003851Zinc finger, Dof-type
PROSITE patternPS01361080116IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MSANSNNHPN HPHHLQRQES GNLVSGHQVL SNHFPQNPNP NHHVNTTSAA TVDPANINGS  60
VAERARLAKN SQPPEGVLKC PRCDSANTKF CYFNNYNLTQ PRHFCKACRR YWTRGGALRN  120
VPVGGGCRRN KKGKTGNSKS SSSQNKQSTS MVNAPSPTTT SNVQLQTNSQ FPFLPTLQNL  180
TQLGGIGLNL AAINGNNGGN GNFLNELGLF HGANTTGPVM ANNNNENNIM TSLGSASHFA  240
MFDRTMGLYS LPNEGYMGNN MGLSSSSASR VTQTAPVKME ETHLGNIISR PVSGLTSLGN  300
QSNQYWTGLG LPGSSSNDHQ QHLM*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00281DAPTransfer from AT2G28810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10016938m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0057270.0AC005727.3 Arabidopsis thaliana chromosome 2 clone F8N16 map mi54, complete sequence.
GenBankBT0328770.0BT032877.1 Arabidopsis thaliana unknown protein (At2g28810) mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006409916.10.0dof zinc finger protein DOF2.2 isoform X2
SwissprotQ9ZV331e-163DOF22_ARATH; Dof zinc finger protein DOF2.2
TrEMBLV4M5470.0V4M547_EUTSA; Uncharacterized protein
STRINGXP_006409916.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.21e-125Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]