PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10016923m
Common NameEUTSA_v10016923mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 328aa    MW: 36253.8 Da    PI: 6.5926
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10016923mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.4e-10195238548
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                      kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  +
  Thhalv10016923m 195 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQAEVSVLSPR 238
                      8999********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.8E-13191255IPR004827Basic-leucine zipper domain
PfamPF077163.9E-9193240IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.634193256IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.18E-11195249No hitNo description
Gene3DG3DSA:1.20.5.1704.0E-13195246No hitNo description
CDDcd147031.95E-23196246No hitNo description
PROSITE patternPS000360198213IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MAQLPPKIPN MTPHWPDFSS QKLSPFSTAA APAATTASAV SVQNPSWVDE FLDFSASRRG  60
NHRRSISDSI AFLEAPAVTG HVSIESHHFD RFDDEQFMSM FTDDDDDLRN NLSHSNNNNN  120
NKNVGATGSS SNTSTPSDHN SFKDDNKEPP SDHNAKDNNN SNDEVQSQCK TEPEDGTASN  180
NNSGDSSGNR ILDPKRVKRI LANRQSAQRS RVRKLQYISE LERSVTSLQA EVSVLSPRVA  240
FLDHQRLLLN VDNSSLKQRI AALAQDKIFK DAHQEALKKE IERLRQVYQQ QSLKKVENVN  300
HSPATGVGAT SAVDIKPSIE KEQLLNV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411496.10.0hypothetical protein EUTSA_v10016923mg
SwissprotF4IN231e-170BZP34_ARATH; Basic leucine zipper 34
TrEMBLV4M9C20.0V4M9C2_EUTSA; Uncharacterized protein
STRINGAT2G42380.21e-168(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.21e-146bZIP family protein