PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10016819m
Common NameEUTSA_v10016819mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 372aa    MW: 40920.9 Da    PI: 6.3942
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10016819mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.11.2e-10149206562
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l+  +     l se
  Thhalv10016819m 149 KRAKRIIANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLSLFQRDTTGLSSE 206
                      9*****************************************9999887776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.3E-17145209IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.622147210IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.97E-10149200No hitNo description
PfamPF001701.7E-9149207IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.3E-9149204No hitNo description
CDDcd147031.16E-22150199No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MDDPSNAKSN QCPPLANPAP TPAPFRGPYH RRAHSEVQFR LPEDLDLSEP FGGFDELGSE  60
DDLFCSYMDI EKLGSGSGSA SDSAGPSAPR SDNPFSAENG GLGRDDAGNS RPRHRHSLSV  120
DGSSTLESIE AKKAMAPDKL AELWVVDPKR AKRIIANRQS AARSKERKAR YILELERKVQ  180
TLQTEATTLS AQLSLFQRDT TGLSSENTEL KLRLQVMEQQ AKLRDALNDQ LKKEVERLKF  240
ATGEVSPADA YNLGMAHMQY SQQQPQQSYY QHHQQQTDAQ NLQQMTHQFH LFQPNNNQNP  300
NITSSSSCQN PPSAHQLMHH ATSNASGQSH SFSEAMHEDP LGRLQGLDIS SCGRGSNFGR  360
SDTVSESSST M*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0967460.0AY096746.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankAY0742690.0AY074269.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankZ860930.0Z86093.1 A.thaliana mRNA for b-Zip DNA binding protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411330.10.0hypothetical protein EUTSA_v10016819mg
SwissprotQ6S4P46e-96RF2B_ORYSJ; Transcription factor RF2b
TrEMBLV4MJI30.0V4MJI3_EUTSA; Uncharacterized protein
STRINGAT2G40620.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.10.0bZIP family protein