PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10016792m
Common NameEUTSA_v10016790mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 385aa    MW: 42804.4 Da    PI: 6.5166
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10016792mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.4e-10197255563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l  l+     l+ e+
  Thhalv10016792m 197 KRAKRIWANRQSAARSKERKTRYIFELERKVQTLQTEATTLSAQLTLLQRDTNGLTVEN 255
                      9********************************************99998887777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.2E-15193257IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.565195258IPR004827Basic-leucine zipper domain
PfamPF001706.9E-9197249IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.5E-11197251No hitNo description
SuperFamilySSF579591.97E-10197248No hitNo description
CDDcd147033.36E-22198247No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MDKEKSPAPC GGLPPPSPSG RCSAFSDAGH GPDTNRLSHD ISRMLDNPPK KIGHRRAHSE  60
ILTLPDDLSF DSDLGVVGTN ADGASFSDDT EEDLLSIYLD MDKFNSSATS SAQVGEPSGT  120
SWKNESKMHT GSTSNPQNTL NSFGERPRVR HQHSQSMDGS MNINEMLMSG NEDDSTVDAK  180
KSMSAAKLAE LALIDPKRAK RIWANRQSAA RSKERKTRYI FELERKVQTL QTEATTLSAQ  240
LTLLQRDTNG LTVENNELKL RLQTMEQQVH LQDELNEALK EEIQHLKVLT GQAAPNGASA  300
MNYGSLGSNQ QFYSNNQSMQ TILAAQQFQQ LQIHSQKQLQ HQQQFQLQQQ QLQQLLNHRL  360
QQQEQQNGIA EMRKQKPSQG QNES*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3532830.0AK353283.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-24-D07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410269.10.0hypothetical protein EUTSA_v10016790mg
RefseqXP_006410270.10.0hypothetical protein EUTSA_v10016790mg
SwissprotQ040880.0POF21_ARATH; Probable transcription factor PosF21
TrEMBLE4MXN60.0E4MXN6_EUTHA; mRNA, clone: RTFL01-24-D07
TrEMBLV4M9E90.0V4M9E9_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.4__1126__AT2G31370.40.0(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31370.50.0bZIP family protein